Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | FXY97_RS05770 | Genome accession | NZ_LR698954 |
| Coordinates | 1113935..1114420 (+) | Length | 161 a.a. |
| NCBI ID | WP_014569470.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus isolate MGYG-HGUT-01293 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1102527..1147716 | 1113935..1114420 | within | 0 |
Gene organization within MGE regions
Location: 1102527..1147716
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FXY97_RS05670 | - | 1102527..1103711 (-) | 1185 | WP_014569455.1 | tyrosine-type recombinase/integrase | - |
| FXY97_RS05675 | - | 1103858..1104088 (+) | 231 | WP_223804796.1 | hypothetical protein | - |
| FXY97_RS05680 | - | 1104056..1105057 (-) | 1002 | WP_014569456.1 | hypothetical protein | - |
| FXY97_RS05685 | - | 1105168..1105371 (-) | 204 | WP_005716134.1 | hypothetical protein | - |
| FXY97_RS05690 | - | 1105395..1105820 (-) | 426 | WP_015764910.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| FXY97_RS15605 | - | 1105954..1106121 (+) | 168 | WP_016364973.1 | hypothetical protein | - |
| FXY97_RS05695 | - | 1106206..1106424 (+) | 219 | WP_016364974.1 | hypothetical protein | - |
| FXY97_RS05700 | - | 1106425..1107180 (-) | 756 | WP_003606998.1 | hypothetical protein | - |
| FXY97_RS05705 | - | 1107287..1107988 (-) | 702 | WP_014569458.1 | DUF3862 domain-containing protein | - |
| FXY97_RS05710 | - | 1108048..1108470 (-) | 423 | WP_014569459.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FXY97_RS05715 | - | 1108460..1108795 (-) | 336 | WP_005714743.1 | helix-turn-helix domain-containing protein | - |
| FXY97_RS05720 | - | 1108933..1109175 (+) | 243 | WP_014569460.1 | helix-turn-helix transcriptional regulator | - |
| FXY97_RS05725 | - | 1109172..1109420 (+) | 249 | WP_029943629.1 | hypothetical protein | - |
| FXY97_RS05730 | - | 1109417..1109644 (-) | 228 | WP_014569461.1 | hypothetical protein | - |
| FXY97_RS15425 | - | 1109732..1109890 (+) | 159 | WP_014569462.1 | hypothetical protein | - |
| FXY97_RS05735 | - | 1109956..1110504 (+) | 549 | WP_014569463.1 | hypothetical protein | - |
| FXY97_RS05740 | - | 1110483..1110713 (+) | 231 | WP_015764912.1 | helix-turn-helix domain-containing protein | - |
| FXY97_RS15675 | - | 1110717..1110845 (+) | 129 | WP_014569465.1 | hypothetical protein | - |
| FXY97_RS05745 | - | 1110857..1111084 (+) | 228 | WP_014569466.1 | hypothetical protein | - |
| FXY97_RS05750 | - | 1111077..1111247 (+) | 171 | WP_015764913.1 | hypothetical protein | - |
| FXY97_RS05755 | - | 1111291..1112166 (+) | 876 | WP_014569467.1 | recombinase RecT | - |
| FXY97_RS05760 | - | 1112186..1112950 (+) | 765 | WP_014569468.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| FXY97_RS05765 | - | 1112966..1113922 (+) | 957 | WP_014569469.1 | DnaD domain-containing protein | - |
| FXY97_RS05770 | ssb | 1113935..1114420 (+) | 486 | WP_014569470.1 | single-stranded DNA-binding protein | Machinery gene |
| FXY97_RS05775 | - | 1114438..1114653 (+) | 216 | WP_014569471.1 | helix-turn-helix domain-containing protein | - |
| FXY97_RS05780 | - | 1114650..1114841 (+) | 192 | WP_015764330.1 | helix-turn-helix domain-containing protein | - |
| FXY97_RS05785 | - | 1115211..1115660 (+) | 450 | WP_014569472.1 | hypothetical protein | - |
| FXY97_RS05790 | - | 1115707..1115961 (+) | 255 | WP_014569473.1 | hypothetical protein | - |
| FXY97_RS05795 | - | 1115958..1116359 (+) | 402 | WP_014569474.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FXY97_RS05800 | - | 1116372..1116836 (+) | 465 | WP_014569475.1 | hypothetical protein | - |
| FXY97_RS05805 | - | 1116848..1117033 (+) | 186 | WP_014569476.1 | hypothetical protein | - |
| FXY97_RS05810 | - | 1117030..1117536 (+) | 507 | WP_014569477.1 | DUF1642 domain-containing protein | - |
| FXY97_RS05815 | - | 1117526..1117705 (+) | 180 | WP_015764915.1 | hypothetical protein | - |
| FXY97_RS05820 | - | 1117692..1117895 (+) | 204 | WP_029943632.1 | hypothetical protein | - |
| FXY97_RS05825 | - | 1117885..1118316 (+) | 432 | WP_014569478.1 | hypothetical protein | - |
| FXY97_RS05830 | - | 1118313..1118675 (+) | 363 | WP_015764916.1 | hypothetical protein | - |
| FXY97_RS05835 | - | 1118672..1118911 (+) | 240 | WP_014569479.1 | hypothetical protein | - |
| FXY97_RS05840 | - | 1118961..1119143 (+) | 183 | WP_029943634.1 | hypothetical protein | - |
| FXY97_RS05850 | - | 1119438..1119866 (+) | 429 | WP_005711378.1 | hypothetical protein | - |
| FXY97_RS05855 | - | 1120894..1122042 (+) | 1149 | WP_014569480.1 | GcrA family cell cycle regulator | - |
| FXY97_RS05860 | - | 1122055..1122597 (+) | 543 | WP_014569481.1 | NUMOD4 domain-containing protein | - |
| FXY97_RS05865 | - | 1122590..1122910 (+) | 321 | WP_015764918.1 | ribonucleoside-diphosphate reductase | - |
| FXY97_RS05870 | - | 1122947..1123480 (+) | 534 | WP_014569483.1 | terminase small subunit | - |
| FXY97_RS05875 | - | 1123458..1124813 (+) | 1356 | WP_029943635.1 | PBSX family phage terminase large subunit | - |
| FXY97_RS05880 | - | 1124818..1126245 (+) | 1428 | WP_014569485.1 | phage portal protein | - |
| FXY97_RS05885 | - | 1126211..1127203 (+) | 993 | WP_014569486.1 | minor capsid protein | - |
| FXY97_RS05890 | - | 1127328..1127984 (+) | 657 | WP_014569487.1 | DUF4355 domain-containing protein | - |
| FXY97_RS05895 | - | 1128000..1129013 (+) | 1014 | WP_014569488.1 | hypothetical protein | - |
| FXY97_RS05900 | - | 1129241..1129615 (+) | 375 | WP_014569489.1 | phage head-tail connector protein | - |
| FXY97_RS05905 | - | 1129620..1129922 (+) | 303 | WP_014569490.1 | hypothetical protein | - |
| FXY97_RS05910 | - | 1129919..1130284 (+) | 366 | WP_015764920.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FXY97_RS05915 | - | 1130285..1130689 (+) | 405 | WP_014569492.1 | DUF3168 domain-containing protein | - |
| FXY97_RS05920 | - | 1130701..1131303 (+) | 603 | WP_014569493.1 | phage tail tube protein | - |
| FXY97_RS05925 | - | 1131390..1131722 (+) | 333 | WP_014569494.1 | tail assembly chaperone | - |
| FXY97_RS05930 | - | 1131827..1132180 (+) | 354 | WP_015764921.1 | hypothetical protein | - |
| FXY97_RS05935 | - | 1132173..1135262 (+) | 3090 | WP_014569496.1 | tape measure protein | - |
| FXY97_RS05940 | - | 1135265..1137253 (+) | 1989 | WP_015764922.1 | distal tail protein Dit | - |
| FXY97_RS05945 | - | 1137253..1139760 (+) | 2508 | WP_014569498.1 | phage tail protein | - |
| FXY97_RS05950 | - | 1139770..1140093 (+) | 324 | WP_005686996.1 | hypothetical protein | - |
| FXY97_RS15680 | - | 1140086..1140217 (+) | 132 | WP_014569499.1 | XkdX family protein | - |
| FXY97_RS05960 | - | 1140247..1140540 (+) | 294 | WP_014569500.1 | hypothetical protein | - |
| FXY97_RS05965 | - | 1140530..1140943 (+) | 414 | WP_014569501.1 | phage holin | - |
| FXY97_RS05970 | - | 1140954..1142252 (+) | 1299 | WP_014569502.1 | LysM peptidoglycan-binding domain-containing protein | - |
| FXY97_RS15745 | - | 1142450..1142524 (+) | 75 | Protein_1061 | glucose-6-phosphate isomerase | - |
| FXY97_RS05975 | - | 1142872..1143159 (-) | 288 | WP_005685833.1 | putative quinol monooxygenase | - |
| FXY97_RS05980 | - | 1143455..1144306 (-) | 852 | WP_005685835.1 | DNA/RNA non-specific endonuclease | - |
| FXY97_RS05985 | - | 1144306..1145049 (-) | 744 | WP_014569504.1 | hypothetical protein | - |
| FXY97_RS05990 | - | 1145178..1146341 (-) | 1164 | WP_005713749.1 | glycosyltransferase | - |
| FXY97_RS05995 | - | 1146799..1147716 (+) | 918 | WP_014569505.1 | Gfo/Idh/MocA family protein | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17695.37 Da Isoelectric Point: 5.8947
>NTDB_id=1128633 FXY97_RS05770 WP_014569470.1 1113935..1114420(+) (ssb) [Lacticaseibacillus rhamnosus isolate MGYG-HGUT-01293]
MLNSVSLTGRLTRDVDLRYTQSGTETGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
MLNSVSLTGRLTRDVDLRYTQSGTETGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=1128633 FXY97_RS05770 WP_014569470.1 1113935..1114420(+) (ssb) [Lacticaseibacillus rhamnosus isolate MGYG-HGUT-01293]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGAGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAGCAGCGACCACGAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGAGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAGCAGCGACCACGAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
61.047 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.674 |
100 |
0.509 |