Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/comE2   Type   Regulator
Locus tag   FGL05_RS09570 Genome accession   NZ_LR594044
Coordinates   195290..195418 (+) Length   42 a.a.
NCBI ID   WP_260665384.1    Uniprot ID   -
Organism   Streptococcus lutetiensis strain NCTC8796     
Function   activate transcription of early competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 180523..195279 195290..195418 flank 11


Gene organization within MGE regions


Location: 180523..195418
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL05_RS00910 (NCTC8796_00192) - 180523..181236 (+) 714 WP_013852281.1 metal ABC transporter ATP-binding protein -
  FGL05_RS00915 (NCTC8796_00193) - 181247..182065 (+) 819 WP_230318133.1 metal ABC transporter permease -
  FGL05_RS00920 (NCTC8796_00194) - 182373..183478 (+) 1106 Protein_184 IS3 family transposase -
  FGL05_RS09235 (NCTC8796_00195) - 183598..184101 (-) 504 WP_233422878.1 CPBP family intramembrane glutamic endopeptidase -
  FGL05_RS00930 (NCTC8796_00196) - 184960..185928 (-) 969 WP_111713006.1 L-lactate dehydrogenase -
  FGL05_RS09240 (NCTC8796_00197) - 186407..186733 (+) 327 WP_041973728.1 hypothetical protein -
  FGL05_RS09245 (NCTC8796_00198) - 186737..187981 (+) 1245 WP_231844747.1 Cna B-type domain-containing protein -
  FGL05_RS09250 (NCTC8796_00199) - 187978..188661 (+) 684 WP_231872449.1 Cna B-type domain-containing protein -
  FGL05_RS09255 - 188666..188741 (+) 76 Protein_190 hypothetical protein -
  FGL05_RS00940 (NCTC8796_00200) - 188878..189648 (+) 771 WP_003066600.1 TatD family hydrolase -
  FGL05_RS00945 (NCTC8796_00201) rnmV 189641..190210 (+) 570 WP_167394768.1 ribonuclease M5 -
  FGL05_RS00950 (NCTC8796_00202) rsmA 190333..191205 (+) 873 WP_021143191.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
  FGL05_RS00955 - 191612..191761 (+) 150 WP_020917491.1 hypothetical protein -
  FGL05_RS00960 (NCTC8796_00203) - 191774..192079 (+) 306 WP_020917490.1 bacteriocin immunity protein -
  FGL05_RS00965 (NCTC8796_00204) - 192107..192400 (+) 294 WP_020917489.1 bacteriocin immunity protein -
  FGL05_RS00970 (NCTC8796_00206) comD/comD2 193317..194129 (+) 813 WP_171009914.1 GHKL domain-containing protein Regulator
  FGL05_RS09260 (NCTC8796_00207) comE/comE2 194687..194914 (+) 228 WP_233422877.1 hypothetical protein Regulator
  FGL05_RS09565 (NCTC8796_00208) comE/comE2 194899..195279 (+) 381 WP_267895290.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  FGL05_RS09570 comE/comE2 195290..195418 (+) 129 WP_260665384.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator

Sequence


Protein


Download         Length: 42 a.a.        Molecular weight: 5067.91 Da        Isoelectric Point: 9.5746

>NTDB_id=1127711 FGL05_RS09570 WP_260665384.1 195290..195418(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
MNLNNIVRLDKKEGLVYFDDDKACYVSRKYIKDLRSKMENLK

Nucleotide


Download         Length: 129 bp        

>NTDB_id=1127711 FGL05_RS09570 WP_260665384.1 195290..195418(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
ATTAACCTAAATAATATTGTTAGGTTAGATAAAAAAGAAGGTTTGGTTTATTTTGACGATGATAAAGCTTGTTATGTTTC
TAGAAAATATATCAAAGACTTAAGGTCAAAAATGGAAAATCTGAAATAG

Domains


Predicted by InterproScan.

(2-38)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/comE2 Streptococcus equinus JB1

97.619

100

0.976


Multiple sequence alignment