Detailed information
Overview
| Name | comE/comE2 | Type | Regulator |
| Locus tag | FGL05_RS09570 | Genome accession | NZ_LR594044 |
| Coordinates | 195290..195418 (+) | Length | 42 a.a. |
| NCBI ID | WP_260665384.1 | Uniprot ID | - |
| Organism | Streptococcus lutetiensis strain NCTC8796 | ||
| Function | activate transcription of early competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 180523..195279 | 195290..195418 | flank | 11 |
Gene organization within MGE regions
Location: 180523..195418
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL05_RS00910 (NCTC8796_00192) | - | 180523..181236 (+) | 714 | WP_013852281.1 | metal ABC transporter ATP-binding protein | - |
| FGL05_RS00915 (NCTC8796_00193) | - | 181247..182065 (+) | 819 | WP_230318133.1 | metal ABC transporter permease | - |
| FGL05_RS00920 (NCTC8796_00194) | - | 182373..183478 (+) | 1106 | Protein_184 | IS3 family transposase | - |
| FGL05_RS09235 (NCTC8796_00195) | - | 183598..184101 (-) | 504 | WP_233422878.1 | CPBP family intramembrane glutamic endopeptidase | - |
| FGL05_RS00930 (NCTC8796_00196) | - | 184960..185928 (-) | 969 | WP_111713006.1 | L-lactate dehydrogenase | - |
| FGL05_RS09240 (NCTC8796_00197) | - | 186407..186733 (+) | 327 | WP_041973728.1 | hypothetical protein | - |
| FGL05_RS09245 (NCTC8796_00198) | - | 186737..187981 (+) | 1245 | WP_231844747.1 | Cna B-type domain-containing protein | - |
| FGL05_RS09250 (NCTC8796_00199) | - | 187978..188661 (+) | 684 | WP_231872449.1 | Cna B-type domain-containing protein | - |
| FGL05_RS09255 | - | 188666..188741 (+) | 76 | Protein_190 | hypothetical protein | - |
| FGL05_RS00940 (NCTC8796_00200) | - | 188878..189648 (+) | 771 | WP_003066600.1 | TatD family hydrolase | - |
| FGL05_RS00945 (NCTC8796_00201) | rnmV | 189641..190210 (+) | 570 | WP_167394768.1 | ribonuclease M5 | - |
| FGL05_RS00950 (NCTC8796_00202) | rsmA | 190333..191205 (+) | 873 | WP_021143191.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| FGL05_RS00955 | - | 191612..191761 (+) | 150 | WP_020917491.1 | hypothetical protein | - |
| FGL05_RS00960 (NCTC8796_00203) | - | 191774..192079 (+) | 306 | WP_020917490.1 | bacteriocin immunity protein | - |
| FGL05_RS00965 (NCTC8796_00204) | - | 192107..192400 (+) | 294 | WP_020917489.1 | bacteriocin immunity protein | - |
| FGL05_RS00970 (NCTC8796_00206) | comD/comD2 | 193317..194129 (+) | 813 | WP_171009914.1 | GHKL domain-containing protein | Regulator |
| FGL05_RS09260 (NCTC8796_00207) | comE/comE2 | 194687..194914 (+) | 228 | WP_233422877.1 | hypothetical protein | Regulator |
| FGL05_RS09565 (NCTC8796_00208) | comE/comE2 | 194899..195279 (+) | 381 | WP_267895290.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | Regulator |
| FGL05_RS09570 | comE/comE2 | 195290..195418 (+) | 129 | WP_260665384.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | Regulator |
Sequence
Protein
Download Length: 42 a.a. Molecular weight: 5067.91 Da Isoelectric Point: 9.5746
>NTDB_id=1127711 FGL05_RS09570 WP_260665384.1 195290..195418(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
MNLNNIVRLDKKEGLVYFDDDKACYVSRKYIKDLRSKMENLK
MNLNNIVRLDKKEGLVYFDDDKACYVSRKYIKDLRSKMENLK
Nucleotide
Download Length: 129 bp
>NTDB_id=1127711 FGL05_RS09570 WP_260665384.1 195290..195418(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
ATTAACCTAAATAATATTGTTAGGTTAGATAAAAAAGAAGGTTTGGTTTATTTTGACGATGATAAAGCTTGTTATGTTTC
TAGAAAATATATCAAAGACTTAAGGTCAAAAATGGAAAATCTGAAATAG
ATTAACCTAAATAATATTGTTAGGTTAGATAAAAAAGAAGGTTTGGTTTATTTTGACGATGATAAAGCTTGTTATGTTTC
TAGAAAATATATCAAAGACTTAAGGTCAAAAATGGAAAATCTGAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE/comE2 | Streptococcus equinus JB1 |
97.619 |
100 |
0.976 |