Detailed information NTG1127709

Bioinformatically predicted

Overview

• Name: comE/comE2
• Type: Regulator
• Locus tag: FGL05_RS09260
• Genome accession: NZ_LR594044
• Coordinates: 194687..194914 (+)
• Length: 75 a.a.
• NCBI ID: WP_233422877.1
• Uniprot ID: -
• Organism: Streptococcus lutetiensis strain NCTC8796
• Function: activate transcription of early competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	180523..195279	194687..194914	within	0

Gene organization within MGE regions

Location: 180523..195279

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FGL05_RS00910 (NCTC8796_00192)	-	180523..181236 (+)	714	WP_013852281.1	metal ABC transporter ATP-binding protein	-
FGL05_RS00915 (NCTC8796_00193)	-	181247..182065 (+)	819	WP_230318133.1	metal ABC transporter permease	-
FGL05_RS00920 (NCTC8796_00194)	-	182373..183478 (+)	1106	Protein_184	IS3 family transposase	-
FGL05_RS09235 (NCTC8796_00195)	-	183598..184101 (-)	504	WP_233422878.1	CPBP family intramembrane glutamic endopeptidase	-
FGL05_RS00930 (NCTC8796_00196)	-	184960..185928 (-)	969	WP_111713006.1	L-lactate dehydrogenase	-
FGL05_RS09240 (NCTC8796_00197)	-	186407..186733 (+)	327	WP_041973728.1	hypothetical protein	-
FGL05_RS09245 (NCTC8796_00198)	-	186737..187981 (+)	1245	WP_231844747.1	Cna B-type domain-containing protein	-
FGL05_RS09250 (NCTC8796_00199)	-	187978..188661 (+)	684	WP_231872449.1	Cna B-type domain-containing protein	-
FGL05_RS09255	-	188666..188741 (+)	76	Protein_190	hypothetical protein	-
FGL05_RS00940 (NCTC8796_00200)	-	188878..189648 (+)	771	WP_003066600.1	TatD family hydrolase	-
FGL05_RS00945 (NCTC8796_00201)	rnmV	189641..190210 (+)	570	WP_167394768.1	ribonuclease M5	-
FGL05_RS00950 (NCTC8796_00202)	rsmA	190333..191205 (+)	873	WP_021143191.1	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	-
FGL05_RS00955	-	191612..191761 (+)	150	WP_020917491.1	hypothetical protein	-
FGL05_RS00960 (NCTC8796_00203)	-	191774..192079 (+)	306	WP_020917490.1	bacteriocin immunity protein	-
FGL05_RS00965 (NCTC8796_00204)	-	192107..192400 (+)	294	WP_020917489.1	bacteriocin immunity protein	-
FGL05_RS00970 (NCTC8796_00206)	comD/comD2	193317..194129 (+)	813	WP_171009914.1	GHKL domain-containing protein	Regulator
FGL05_RS09260 (NCTC8796_00207)	comE/comE2	194687..194914 (+)	228	WP_233422877.1	hypothetical protein	Regulator
FGL05_RS09565 (NCTC8796_00208)	comE/comE2	194899..195279 (+)	381	WP_267895290.1	LytTR family transcriptional regulator DNA-binding domain-containing protein	Regulator

Sequence

Protein

• Length: 75 a.a.
• Molecular weight: 9278.77 Da
• Isoelectric Point: 4.2694

>NTDB_id=1127709 FGL05_RS09260 WP_233422877.1 194687..194914(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
MIDIYVLENNVNQQFRIEKMIGDLLETNQWETRHFDLFSETDCLINLVEEPFPQFFSWILIFMEIIPKELKWLRR

Nucleotide

• Length: 228 bp

>NTDB_id=1127709 FGL05_RS09260 WP_233422877.1 194687..194914(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
ATGATTGATATCTATGTATTAGAAAATAATGTAAATCAGCAGTTTCGTATTGAGAAAATGATTGGAGATTTGCTGGAGAC
AAATCAGTGGGAAACTCGTCATTTTGATTTATTTAGTGAAACTGATTGTTTAATTAACCTAGTTGAGGAGCCTTTTCCTC
AATTTTTTTCCTGGATATTGATATTCATGGAGATAATACCAAAGGAATTGAAGTGGCTAAGGCGATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE/comE2	Streptococcus equinus JB1	91.071	74.667	0.68