Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   T556_RS03150 Genome accession   NZ_CP003974
Coordinates   521634..522107 (+) Length   157 a.a.
NCBI ID   WP_012503482.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae NG-k51.05     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 522177..561044 521634..522107 flank 70


Gene organization within MGE regions


Location: 521634..561044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  T556_RS03150 (T556_02850) pilL 521634..522107 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  T556_RS03155 (T556_02855) - 522177..522485 (-) 309 WP_003706588.1 AzlD family protein -
  T556_RS03160 (T556_02860) - 522482..523193 (-) 712 Protein_524 AzlC family ABC transporter permease -
  T556_RS03165 (T556_02865) dut 523359..523811 (+) 453 WP_003701071.1 dUTP diphosphatase -
  T556_RS03170 (T556_02870) dapC 523883..525070 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  T556_RS03175 (T556_02875) yaaA 525226..526005 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  T556_RS03190 (T556_02890) - 526535..527735 (+) 1201 Protein_528 tyrosine-type recombinase/integrase -
  T556_RS03205 (T556_02895) - 528091..528360 (-) 270 WP_003687928.1 hypothetical protein -
  T556_RS03210 (T556_02900) - 528555..529238 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  T556_RS14900 - 529519..529785 (-) 267 Protein_531 hypothetical protein -
  T556_RS03220 (T556_02910) - 529896..530111 (-) 216 WP_003691538.1 hypothetical protein -
  T556_RS03225 (T556_02915) - 530163..530654 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  T556_RS03230 (T556_02920) - 530651..530833 (-) 183 WP_003691535.1 hypothetical protein -
  T556_RS03235 (T556_02925) - 530973..531659 (-) 687 WP_012503754.1 phage replication initiation protein, NGO0469 family -
  T556_RS03240 (T556_02930) - 531728..531889 (-) 162 WP_003702497.1 hypothetical protein -
  T556_RS03245 (T556_02935) - 531886..532164 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  T556_RS03250 (T556_02940) - 532317..532649 (-) 333 WP_047922517.1 hypothetical protein -
  T556_RS03255 (T556_02945) - 532790..533077 (-) 288 WP_104691805.1 hypothetical protein -
  T556_RS03260 (T556_02950) - 533074..533550 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  T556_RS03265 (T556_02955) - 533583..533783 (-) 201 WP_003704298.1 hypothetical protein -
  T556_RS03270 (T556_02960) - 533981..534394 (-) 414 WP_003687963.1 hypothetical protein -
  T556_RS03275 (T556_02965) - 534391..534852 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  T556_RS03280 (T556_02970) - 534869..535306 (-) 438 WP_003687967.1 hypothetical protein -
  T556_RS03285 (T556_02975) - 535421..536137 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  T556_RS03290 (T556_02980) - 536212..536442 (+) 231 WP_020997318.1 transcriptional regulator -
  T556_RS03295 (T556_02985) - 536521..536676 (+) 156 WP_003691446.1 hypothetical protein -
  T556_RS03300 (T556_02990) - 536653..536841 (-) 189 WP_003698903.1 hypothetical protein -
  T556_RS03305 (T556_02995) - 537014..537241 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  T556_RS13855 (T556_03000) - 537238..537375 (+) 138 WP_010359998.1 hypothetical protein -
  T556_RS14370 - 537920..538423 (+) 504 WP_010360005.1 hypothetical protein -
  T556_RS03315 (T556_03010) - 538420..539781 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  T556_RS03320 (T556_03015) - 539798..540082 (+) 285 WP_237076671.1 hypothetical protein -
  T556_RS03325 (T556_03020) - 540121..540615 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  T556_RS03335 - 540999..541148 (+) 150 WP_012503493.1 hypothetical protein -
  T556_RS14375 (T556_03030) - 541177..541458 (+) 282 WP_003689109.1 hypothetical protein -
  T556_RS03340 (T556_03035) - 541449..541886 (+) 438 WP_041421250.1 RusA family crossover junction endodeoxyribonuclease -
  T556_RS03345 (T556_03040) - 541879..542184 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  T556_RS03350 (T556_03045) - 542181..542564 (+) 384 WP_003687982.1 recombination protein NinB -
  T556_RS03355 (T556_03050) - 542555..543073 (+) 519 WP_003687984.1 HNH endonuclease -
  T556_RS03360 (T556_03055) - 543138..543560 (+) 423 WP_003690919.1 hypothetical protein -
  T556_RS14380 (T556_03060) - 543560..544099 (+) 540 WP_003690920.1 hypothetical protein -
  T556_RS03375 (T556_03065) - 544080..545354 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  T556_RS03380 (T556_03070) - 545339..547606 (+) 2268 WP_228369784.1 hypothetical protein -
  T556_RS03385 (T556_03080) - 548024..549040 (+) 1017 WP_237076672.1 hypothetical protein -
  T556_RS15070 (T556_03090) - 549037..556343 (+) 7307 Protein_566 PLxRFG domain-containing protein -
  T556_RS14395 (T556_03095) - 556268..557005 (+) 738 WP_003690932.1 hypothetical protein -
  T556_RS03405 (T556_03100) - 557026..558321 (+) 1296 WP_003690933.1 DUF4043 family protein -
  T556_RS03410 (T556_03105) - 558376..558849 (+) 474 WP_003690936.1 hypothetical protein -
  T556_RS03415 (T556_03110) - 558855..559340 (+) 486 WP_003687997.1 hypothetical protein -
  T556_RS03420 - 559337..559612 (+) 276 WP_010358526.1 hypothetical protein -
  T556_RS03425 - 559603..560010 (+) 408 WP_010358525.1 hypothetical protein -
  T556_RS03430 (T556_03120) - 560013..560162 (+) 150 WP_003706419.1 hypothetical protein -
  T556_RS03435 (T556_03125) - 560199..561044 (-) 846 WP_012503500.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17486.30 Da        Isoelectric Point: 9.9561

>NTDB_id=111889 T556_RS03150 WP_012503482.1 521634..522107(+) (pilL) [Neisseria gonorrhoeae NG-k51.05]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=111889 T556_RS03150 WP_012503482.1 521634..522107(+) (pilL) [Neisseria gonorrhoeae NG-k51.05]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.72

100

0.917
  pilX Neisseria meningitidis 8013

85.35

100

0.854

Multiple sequence alignment