Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EL050_RS17535 Genome accession   NZ_LR134165
Coordinates   3460655..3460795 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain NCTC8721     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3455655..3465795
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL050_RS17510 (NCTC8721_03613) - 3455948..3456337 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  EL050_RS17515 (NCTC8721_03614) comA 3456354..3456992 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  EL050_RS17520 (NCTC8721_03615) comP 3457079..3459394 (-) 2316 WP_126430465.1 ATP-binding protein Regulator
  EL050_RS17525 (NCTC8721_03616) comX 3459415..3459585 (-) 171 WP_020452790.1 competence pheromone ComX -
  EL050_RS17530 (NCTC8721_03617) - 3459557..3460468 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  EL050_RS17535 (NCTC8721_03618) degQ 3460655..3460795 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  EL050_RS17545 (NCTC8721_03619) - 3461407..3461628 (+) 222 WP_230368259.1 hypothetical protein -
  EL050_RS17550 (NCTC8721_03620) - 3461671..3462891 (-) 1221 WP_020452793.1 HDOD domain-containing protein -
  EL050_RS17555 (NCTC8721_03621) - 3463069..3464538 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  EL050_RS17560 (NCTC8721_03622) - 3464556..3465107 (-) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  EL050_RS17565 (NCTC8721_03623) - 3465293..3465694 (-) 402 WP_025809741.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=1118616 EL050_RS17535 WP_003184860.1 3460655..3460795(-) (degQ) [Bacillus paralicheniformis strain NCTC8721]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1118616 EL050_RS17535 WP_003184860.1 3460655..3460795(-) (degQ) [Bacillus paralicheniformis strain NCTC8721]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment