Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MWH27_RS12790 Genome accession   NZ_JALJVV010000001
Coordinates   2373442..2373816 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain A-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2368442..2378816
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MWH27_RS12750 (MWH27_12725) yqhG 2368774..2369568 (+) 795 WP_014480249.1 YqhG family protein -
  MWH27_RS12755 (MWH27_12730) sinI 2369751..2369924 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MWH27_RS12760 (MWH27_12735) sinR 2369958..2370293 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MWH27_RS12765 (MWH27_12740) tasA 2370386..2371171 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  MWH27_RS12770 (MWH27_12745) sipW 2371235..2371807 (-) 573 WP_003230181.1 signal peptidase I SipW -
  MWH27_RS12775 (MWH27_12750) tapA 2371791..2372552 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  MWH27_RS12780 (MWH27_12755) yqzG 2372824..2373150 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MWH27_RS12785 (MWH27_12760) spoIITA 2373192..2373371 (-) 180 WP_014480252.1 YqzE family protein -
  MWH27_RS12790 (MWH27_12765) comGG 2373442..2373816 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MWH27_RS12795 (MWH27_12770) comGF 2373817..2374200 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  MWH27_RS12800 (MWH27_12775) comGE 2374226..2374573 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  MWH27_RS12805 (MWH27_12780) comGD 2374557..2374988 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  MWH27_RS12810 (MWH27_12785) comGC 2374978..2375274 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MWH27_RS12815 (MWH27_12790) comGB 2375288..2376325 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  MWH27_RS12820 (MWH27_12795) comGA 2376312..2377382 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MWH27_RS12825 (MWH27_12800) - 2377594..2377791 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MWH27_RS12830 (MWH27_12805) corA 2377793..2378746 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=1113017 MWH27_RS12790 WP_014480253.1 2373442..2373816(-) (comGG) [Bacillus subtilis strain A-5]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1113017 MWH27_RS12790 WP_014480253.1 2373442..2373816(-) (comGG) [Bacillus subtilis strain A-5]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment