Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACN9KP_RS15100 Genome accession   NZ_CP183947
Coordinates   3071782..3071922 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3066782..3076922
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN9KP_RS15080 (ACN9KP_15080) - 3067093..3067476 (-) 384 WP_044052949.1 hotdog fold thioesterase -
  ACN9KP_RS15085 (ACN9KP_15085) - 3067498..3068128 (-) 631 Protein_2904 response regulator transcription factor -
  ACN9KP_RS15090 (ACN9KP_15090) comP 3068209..3070512 (-) 2304 WP_003152050.1 sensor histidine kinase Regulator
  ACN9KP_RS15095 (ACN9KP_15095) comQ 3070665..3071597 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACN9KP_RS15100 (ACN9KP_15100) degQ 3071782..3071922 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACN9KP_RS15105 (ACN9KP_15105) - 3072388..3072729 (+) 342 WP_014305721.1 hypothetical protein -
  ACN9KP_RS15110 (ACN9KP_15110) - 3072736..3073956 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACN9KP_RS15115 (ACN9KP_15115) - 3074086..3075552 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACN9KP_RS15120 (ACN9KP_15120) - 3075570..3076121 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACN9KP_RS15125 (ACN9KP_15125) - 3076218..3076616 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1107336 ACN9KP_RS15100 WP_003152043.1 3071782..3071922(-) (degQ) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1107336 ACN9KP_RS15100 WP_003152043.1 3071782..3071922(-) (degQ) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment