Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   ACM595_RS00340 Genome accession   NZ_CP183796
Coordinates   81220..81786 (+) Length   188 a.a.
NCBI ID   WP_041079011.1    Uniprot ID   A0A380HNJ5
Organism   Staphylococcus sp. LKG3-1     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 82277..124570 81220..81786 flank 491


Gene organization within MGE regions


Location: 81220..124570
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM595_RS00340 (ACM595_00340) comK/comK1 81220..81786 (+) 567 WP_041079011.1 competence protein ComK Regulator
  ACM595_RS00355 (ACM595_00355) - 82277..83332 (-) 1056 WP_419744367.1 tyrosine-type recombinase/integrase -
  ACM595_RS00360 (ACM595_00360) - 83392..84030 (-) 639 WP_419744368.1 hypothetical protein -
  ACM595_RS00365 (ACM595_00365) - 84045..84509 (-) 465 WP_419744369.1 ImmA/IrrE family metallo-endopeptidase -
  ACM595_RS00370 (ACM595_00370) - 84521..84835 (-) 315 WP_210136405.1 helix-turn-helix domain-containing protein -
  ACM595_RS00375 (ACM595_00375) - 84988..85200 (+) 213 WP_210136404.1 helix-turn-helix transcriptional regulator -
  ACM595_RS00380 (ACM595_00380) - 85242..86204 (+) 963 WP_419744370.1 hypothetical protein -
  ACM595_RS00385 (ACM595_00385) - 86197..86736 (+) 540 WP_419744371.1 ORF6C domain-containing protein -
  ACM595_RS00390 (ACM595_00390) - 86782..87108 (+) 327 WP_210136401.1 DUF771 domain-containing protein -
  ACM595_RS00395 (ACM595_00395) - 87121..87294 (+) 174 WP_419744372.1 hypothetical protein -
  ACM595_RS00400 (ACM595_00400) - 87356..87580 (+) 225 WP_326024551.1 DUF2483 family protein -
  ACM595_RS00405 (ACM595_00405) - 87573..88205 (+) 633 WP_419744373.1 DUF1071 domain-containing protein -
  ACM595_RS00410 (ACM595_00410) ssbA 88195..88635 (+) 441 WP_419744374.1 single-stranded DNA-binding protein Machinery gene
  ACM595_RS00415 (ACM595_00415) - 88649..89320 (+) 672 WP_419744375.1 putative HNHc nuclease -
  ACM595_RS00420 (ACM595_00420) - 89317..90069 (+) 753 WP_419744376.1 DnaD domain protein -
  ACM595_RS00425 (ACM595_00425) - 90073..90435 (+) 363 WP_419744377.1 hypothetical protein -
  ACM595_RS00430 (ACM595_00430) - 90431..91666 (+) 1236 WP_419744484.1 DnaB helicase C-terminal domain-containing protein -
  ACM595_RS00435 (ACM595_00435) - 91663..91875 (+) 213 WP_419744378.1 hypothetical protein -
  ACM595_RS00440 (ACM595_00440) - 91862..92098 (+) 237 WP_129303566.1 DUF3269 family protein -
  ACM595_RS00445 (ACM595_00445) - 92109..92510 (+) 402 WP_069822265.1 DUF1064 domain-containing protein -
  ACM595_RS00450 (ACM595_00450) - 92507..92719 (+) 213 WP_419744379.1 hypothetical protein -
  ACM595_RS00455 (ACM595_00455) - 92733..93086 (+) 354 WP_419744380.1 SA1788 family PVL leukocidin-associated protein -
  ACM595_RS00460 (ACM595_00460) - 93603..93818 (+) 216 Protein_89 DUF3310 domain-containing protein -
  ACM595_RS00465 (ACM595_00465) - 93819..94124 (+) 306 WP_419744381.1 DUF1140 family protein -
  ACM595_RS00470 (ACM595_00470) - 94187..94333 (+) 147 WP_419744382.1 hypothetical protein -
  ACM595_RS00475 (ACM595_00475) - 94326..94679 (+) 354 WP_419744383.1 hypothetical protein -
  ACM595_RS00480 (ACM595_00480) - 94682..94951 (+) 270 WP_210146124.1 hypothetical protein -
  ACM595_RS00485 (ACM595_00485) - 95147..95506 (+) 360 WP_419744485.1 MazG-like family protein -
  ACM595_RS00490 (ACM595_00490) - 95592..95834 (+) 243 WP_419744384.1 hypothetical protein -
  ACM595_RS00495 (ACM595_00495) - 95834..96067 (+) 234 WP_419744385.1 DUF1381 domain-containing protein -
  ACM595_RS00500 (ACM595_00500) rinB 96064..96210 (+) 147 WP_419744386.1 transcriptional activator RinB -
  ACM595_RS00505 (ACM595_00505) - 96226..96642 (+) 417 WP_419744387.1 transcriptional regulator -
  ACM595_RS00510 (ACM595_00510) - 96874..97542 (+) 669 WP_419744388.1 hypothetical protein -
  ACM595_RS00515 (ACM595_00515) - 97605..98042 (+) 438 WP_419744389.1 terminase small subunit -
  ACM595_RS00520 (ACM595_00520) - 98051..99319 (+) 1269 WP_419744390.1 PBSX family phage terminase large subunit -
  ACM595_RS00525 (ACM595_00525) - 99324..100757 (+) 1434 WP_419744391.1 phage portal protein -
  ACM595_RS00530 (ACM595_00530) - 100771..101670 (+) 900 WP_419744392.1 phage minor head protein -
  ACM595_RS00535 (ACM595_00535) - 101764..102357 (+) 594 WP_419744393.1 phage scaffolding protein -
  ACM595_RS00540 (ACM595_00540) - 102376..103194 (+) 819 WP_419744394.1 N4-gp56 family major capsid protein -
  ACM595_RS00545 (ACM595_00545) - 103209..103502 (+) 294 WP_419744395.1 Rho termination factor N-terminal domain-containing protein -
  ACM595_RS00550 (ACM595_00550) - 103502..103816 (+) 315 WP_419744396.1 phage head-tail connector protein -
  ACM595_RS00555 (ACM595_00555) - 103809..104141 (+) 333 WP_419744397.1 phage head closure protein -
  ACM595_RS00560 (ACM595_00560) - 104134..104550 (+) 417 WP_419744398.1 HK97-gp10 family putative phage morphogenesis protein -
  ACM595_RS00565 (ACM595_00565) - 104563..104985 (+) 423 WP_419744399.1 DUF3168 domain-containing protein -
  ACM595_RS00570 (ACM595_00570) - 104989..105516 (+) 528 WP_078072853.1 phage tail protein -
  ACM595_RS00575 (ACM595_00575) - 105575..106072 (+) 498 WP_419744400.1 tail assembly chaperone -
  ACM595_RS00580 (ACM595_00580) - 106126..106422 (+) 297 WP_419744401.1 hypothetical protein -
  ACM595_RS00585 (ACM595_00585) - 106426..109362 (+) 2937 WP_419744402.1 phage tail protein -
  ACM595_RS00590 (ACM595_00590) - 109374..110288 (+) 915 WP_419744403.1 phage tail protein -
  ACM595_RS00595 (ACM595_00595) - 110303..111775 (+) 1473 WP_419744404.1 DUF7643 domain-containing protein -
  ACM595_RS00600 (ACM595_00600) - 111775..113664 (+) 1890 WP_419744405.1 hypothetical protein -
  ACM595_RS00605 (ACM595_00605) - 113665..115590 (+) 1926 WP_419744406.1 BppU family phage baseplate upper protein -
  ACM595_RS00610 (ACM595_00610) - 115590..115937 (+) 348 WP_419744407.1 DUF2977 domain-containing protein -
  ACM595_RS00615 (ACM595_00615) - 115924..116085 (+) 162 WP_078072845.1 XkdX family protein -
  ACM595_RS00620 (ACM595_00620) - 116123..116557 (+) 435 WP_419744408.1 hypothetical protein -
  ACM595_RS00625 (ACM595_00625) - 116541..116945 (+) 405 WP_078072843.1 hypothetical protein -
  ACM595_RS00630 (ACM595_00630) - 116998..118923 (+) 1926 WP_419744409.1 glucosaminidase domain-containing protein -
  ACM595_RS00635 (ACM595_00635) - 119065..121296 (+) 2232 WP_419744410.1 BppU family phage baseplate upper protein -
  ACM595_RS00640 (ACM595_00640) - 121379..121666 (+) 288 WP_419744411.1 phage holin -
  ACM595_RS00645 (ACM595_00645) - 121677..123056 (+) 1380 WP_419744412.1 N-acetylmuramoyl-L-alanine amidase -
  ACM595_RS00650 (ACM595_00650) - 123367..123678 (+) 312 WP_174605002.1 DUF3467 domain-containing protein -
  ACM595_RS00655 (ACM595_00655) - 123665..124060 (+) 396 WP_239466229.1 hypothetical protein -
  ACM595_RS00660 (ACM595_00660) - 124160..124570 (+) 411 WP_419744413.1 YolD-like family protein -

Sequence


Protein


Download         Length: 188 a.a.        Molecular weight: 22118.54 Da        Isoelectric Point: 9.5133

>NTDB_id=1106102 ACM595_RS00340 WP_041079011.1 81220..81786(+) (comK/comK1) [Staphylococcus sp. LKG3-1]
MIQPYIIKKGDMVLQPCSLSTGKYEGSYLLKYKDDSKVLKERVPKIIDRSCRFYGSSYHFKKEDTMRITGISSKPPILFT
PLFPTYFFPTHSDRKEENTWINIHYVHQIKPLKEKKCKVTFVDNQTIVANISAHSMHHQYLNGIYYYYMMDRAARVATFD
PESPIDYTKPQLNIYEALAKYSLFENKS

Nucleotide


Download         Length: 567 bp        

>NTDB_id=1106102 ACM595_RS00340 WP_041079011.1 81220..81786(+) (comK/comK1) [Staphylococcus sp. LKG3-1]
ATGATTCAACCCTATATCATTAAAAAAGGGGATATGGTTTTACAACCATGCAGTTTATCAACTGGTAAGTATGAAGGTAG
TTATCTTTTAAAGTATAAGGATGACAGCAAAGTTCTAAAAGAACGTGTTCCAAAGATTATTGATCGATCGTGTAGATTTT
ATGGTAGTAGTTATCATTTTAAGAAAGAAGATACGATGAGAATTACTGGCATAAGCAGTAAACCCCCAATTTTATTTACT
CCACTTTTTCCTACTTATTTTTTCCCAACGCACTCTGATAGAAAAGAAGAAAATACTTGGATTAATATTCATTATGTTCA
CCAAATCAAACCACTAAAAGAAAAGAAATGTAAAGTGACATTTGTAGATAATCAAACAATTGTAGCTAACATTTCAGCAC
ATAGCATGCATCATCAATACCTAAATGGTATTTATTATTACTATATGATGGATAGGGCAGCAAGAGTTGCTACCTTTGAT
CCAGAATCTCCTATTGATTATACAAAACCTCAATTAAATATTTATGAAGCATTAGCAAAATATTCATTATTTGAAAATAA
ATCGTAG

Domains


Predicted by InterproScan.

(4-152)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A380HNJ5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

54.891

97.872

0.537

  comK/comK1 Staphylococcus aureus N315

54.891

97.872

0.537


Multiple sequence alignment