Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACNM7T_RS11965 Genome accession   NZ_CP183041
Coordinates   2480043..2480216 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain Scm     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2475043..2485216
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNM7T_RS11950 (ACNM7T_11950) gcvT 2475856..2476956 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  ACNM7T_RS11955 (ACNM7T_11955) - 2477380..2479050 (+) 1671 WP_124934996.1 DEAD/DEAH box helicase -
  ACNM7T_RS11960 (ACNM7T_11960) - 2479072..2479866 (+) 795 WP_076424968.1 YqhG family protein -
  ACNM7T_RS11965 (ACNM7T_11965) sinI 2480043..2480216 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACNM7T_RS11970 (ACNM7T_11970) sinR 2480250..2480585 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNM7T_RS11975 (ACNM7T_11975) tasA 2480633..2481418 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACNM7T_RS11980 (ACNM7T_11980) sipW 2481483..2482067 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACNM7T_RS11985 (ACNM7T_11985) tapA 2482039..2482710 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  ACNM7T_RS11990 (ACNM7T_11990) - 2482969..2483298 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACNM7T_RS11995 (ACNM7T_11995) - 2483338..2483517 (-) 180 WP_003153093.1 YqzE family protein -
  ACNM7T_RS12000 (ACNM7T_12000) comGG 2483574..2483951 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNM7T_RS12005 (ACNM7T_12005) comGF 2483952..2484452 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ACNM7T_RS12010 (ACNM7T_12010) comGE 2484361..2484675 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACNM7T_RS12015 (ACNM7T_12015) comGD 2484659..2485096 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1103790 ACNM7T_RS11965 WP_003153105.1 2480043..2480216(+) (sinI) [Bacillus amyloliquefaciens strain Scm]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1103790 ACNM7T_RS11965 WP_003153105.1 2480043..2480216(+) (sinI) [Bacillus amyloliquefaciens strain Scm]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment