Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACNVPQ_RS12005 Genome accession   NZ_CP182318
Coordinates   2483530..2483907 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain Scm3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2478530..2488907
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNVPQ_RS11965 - 2479028..2479822 (+) 795 WP_076424968.1 YqhG family protein -
  ACNVPQ_RS11970 sinI 2479999..2480172 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACNVPQ_RS11975 sinR 2480206..2480541 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNVPQ_RS11980 tasA 2480589..2481374 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACNVPQ_RS11985 sipW 2481439..2482023 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACNVPQ_RS11990 tapA 2481995..2482666 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  ACNVPQ_RS11995 - 2482925..2483254 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACNVPQ_RS12000 - 2483294..2483473 (-) 180 WP_003153093.1 YqzE family protein -
  ACNVPQ_RS12005 comGG 2483530..2483907 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNVPQ_RS12010 comGF 2483908..2484408 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ACNVPQ_RS12015 comGE 2484317..2484631 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACNVPQ_RS12020 comGD 2484615..2485052 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACNVPQ_RS12025 comGC 2485042..2485350 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACNVPQ_RS12030 comGB 2485355..2486392 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACNVPQ_RS12035 comGA 2486379..2487449 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACNVPQ_RS12040 - 2487643..2488593 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1101129 ACNVPQ_RS12005 WP_012117980.1 2483530..2483907(-) (comGG) [Bacillus velezensis strain Scm3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1101129 ACNVPQ_RS12005 WP_012117980.1 2483530..2483907(-) (comGG) [Bacillus velezensis strain Scm3]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment