Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACNVPQ_RS11970 Genome accession   NZ_CP182318
Coordinates   2479999..2480172 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Scm3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2474999..2485172
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNVPQ_RS11955 gcvT 2475812..2476912 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  ACNVPQ_RS11960 - 2477336..2479006 (+) 1671 WP_124934996.1 DEAD/DEAH box helicase -
  ACNVPQ_RS11965 - 2479028..2479822 (+) 795 WP_076424968.1 YqhG family protein -
  ACNVPQ_RS11970 sinI 2479999..2480172 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACNVPQ_RS11975 sinR 2480206..2480541 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNVPQ_RS11980 tasA 2480589..2481374 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACNVPQ_RS11985 sipW 2481439..2482023 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACNVPQ_RS11990 tapA 2481995..2482666 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  ACNVPQ_RS11995 - 2482925..2483254 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACNVPQ_RS12000 - 2483294..2483473 (-) 180 WP_003153093.1 YqzE family protein -
  ACNVPQ_RS12005 comGG 2483530..2483907 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNVPQ_RS12010 comGF 2483908..2484408 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ACNVPQ_RS12015 comGE 2484317..2484631 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACNVPQ_RS12020 comGD 2484615..2485052 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1101127 ACNVPQ_RS11970 WP_003153105.1 2479999..2480172(+) (sinI) [Bacillus velezensis strain Scm3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1101127 ACNVPQ_RS11970 WP_003153105.1 2479999..2480172(+) (sinI) [Bacillus velezensis strain Scm3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment