Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACLQ7P_RS17945 Genome accession   NZ_CP181322
Coordinates   3339976..3340116 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain JCK-1398     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3334976..3345116
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLQ7P_RS17920 (ACLQ7P_17920) yuxO 3335282..3335662 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  ACLQ7P_RS17925 (ACLQ7P_17925) comA 3335681..3336325 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLQ7P_RS17930 (ACLQ7P_17930) comP 3336406..3338718 (-) 2313 WP_121591110.1 two-component system sensor histidine kinase ComP Regulator
  ACLQ7P_RS17935 (ACLQ7P_17935) comX 3338737..3338904 (-) 168 WP_041057586.1 competence pheromone ComX Regulator
  ACLQ7P_RS17940 (ACLQ7P_17940) comQ 3338892..3339791 (-) 900 WP_038828674.1 polyprenyl synthetase family protein Regulator
  ACLQ7P_RS17945 (ACLQ7P_17945) degQ 3339976..3340116 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLQ7P_RS17950 (ACLQ7P_17950) - 3340338..3340463 (+) 126 WP_003228793.1 hypothetical protein -
  ACLQ7P_RS17955 (ACLQ7P_17955) - 3340577..3340945 (+) 369 WP_014477834.1 hypothetical protein -
  ACLQ7P_RS17960 (ACLQ7P_17960) pdeH 3340921..3342150 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  ACLQ7P_RS17965 (ACLQ7P_17965) pncB 3342286..3343758 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  ACLQ7P_RS17970 (ACLQ7P_17970) pncA 3343774..3344325 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  ACLQ7P_RS17975 (ACLQ7P_17975) yueI 3344422..3344820 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1099728 ACLQ7P_RS17945 WP_003220708.1 3339976..3340116(-) (degQ) [Bacillus subtilis subsp. subtilis strain JCK-1398]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1099728 ACLQ7P_RS17945 WP_003220708.1 3339976..3340116(-) (degQ) [Bacillus subtilis subsp. subtilis strain JCK-1398]
ATGGAAAAGAAACTCGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment