Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ACLQ7P_RS17935 Genome accession   NZ_CP181322
Coordinates   3338737..3338904 (-) Length   55 a.a.
NCBI ID   WP_041057586.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain JCK-1398     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3333737..3343904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLQ7P_RS17905 (ACLQ7P_17905) mrpE 3334125..3334601 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  ACLQ7P_RS17910 (ACLQ7P_17910) mrpF 3334601..3334885 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ACLQ7P_RS17915 (ACLQ7P_17915) mnhG 3334869..3335243 (+) 375 WP_014477830.1 monovalent cation/H(+) antiporter subunit G -
  ACLQ7P_RS17920 (ACLQ7P_17920) yuxO 3335282..3335662 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  ACLQ7P_RS17925 (ACLQ7P_17925) comA 3335681..3336325 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLQ7P_RS17930 (ACLQ7P_17930) comP 3336406..3338718 (-) 2313 WP_121591110.1 two-component system sensor histidine kinase ComP Regulator
  ACLQ7P_RS17935 (ACLQ7P_17935) comX 3338737..3338904 (-) 168 WP_041057586.1 competence pheromone ComX Regulator
  ACLQ7P_RS17940 (ACLQ7P_17940) comQ 3338892..3339791 (-) 900 WP_038828674.1 polyprenyl synthetase family protein Regulator
  ACLQ7P_RS17945 (ACLQ7P_17945) degQ 3339976..3340116 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLQ7P_RS17950 (ACLQ7P_17950) - 3340338..3340463 (+) 126 WP_003228793.1 hypothetical protein -
  ACLQ7P_RS17955 (ACLQ7P_17955) - 3340577..3340945 (+) 369 WP_014477834.1 hypothetical protein -
  ACLQ7P_RS17960 (ACLQ7P_17960) pdeH 3340921..3342150 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  ACLQ7P_RS17965 (ACLQ7P_17965) pncB 3342286..3343758 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6646.59 Da        Isoelectric Point: 4.9431

>NTDB_id=1099726 ACLQ7P_RS17935 WP_041057586.1 3338737..3338904(-) (comX) [Bacillus subtilis subsp. subtilis strain JCK-1398]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYRADPITRQWKE

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1099726 ACLQ7P_RS17935 WP_041057586.1 3338737..3338904(-) (comX) [Bacillus subtilis subsp. subtilis strain JCK-1398]
GTGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATTGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTACAATGATTATTATCGGGCTGACCCAATAACTCGTCAATGGA
AAGAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

94.545

100

0.945


Multiple sequence alignment