Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACLQ7P_RS08245 Genome accession   NZ_CP181322
Coordinates   1616227..1616601 (+) Length   124 a.a.
NCBI ID   WP_032726157.1    Uniprot ID   A0AAP2PZF3
Organism   Bacillus subtilis subsp. subtilis strain JCK-1398     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1611227..1621601
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLQ7P_RS08210 (ACLQ7P_08210) corA 1611303..1612255 (+) 953 Protein_1556 magnesium transporter CorA -
  ACLQ7P_RS08215 (ACLQ7P_08215) comGA 1612664..1613734 (+) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  ACLQ7P_RS08220 (ACLQ7P_08220) comGB 1613721..1614758 (+) 1038 WP_121590958.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACLQ7P_RS08225 (ACLQ7P_08225) comGC 1614772..1615068 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACLQ7P_RS08230 (ACLQ7P_08230) comGD 1615058..1615489 (+) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACLQ7P_RS08235 (ACLQ7P_08235) comGE 1615473..1615820 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACLQ7P_RS08240 (ACLQ7P_08240) comGF 1615846..1616226 (+) 381 WP_121590957.1 ComGF family competence protein Machinery gene
  ACLQ7P_RS08245 (ACLQ7P_08245) comGG 1616227..1616601 (+) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  ACLQ7P_RS08250 (ACLQ7P_08250) spoIITA 1616672..1616851 (+) 180 WP_014480252.1 YqzE family protein -
  ACLQ7P_RS08255 (ACLQ7P_08255) yqzG 1616893..1617219 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  ACLQ7P_RS08260 (ACLQ7P_08260) tapA 1617490..1618245 (+) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  ACLQ7P_RS08265 (ACLQ7P_08265) sipW 1618229..1618801 (+) 573 WP_072557060.1 signal peptidase I SipW -
  ACLQ7P_RS08270 (ACLQ7P_08270) tasA 1618866..1619651 (+) 786 WP_017696201.1 biofilm matrix protein TasA -
  ACLQ7P_RS08275 (ACLQ7P_08275) - 1619702..1620949 (-) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  ACLQ7P_RS08280 (ACLQ7P_08280) sinR 1621121..1621456 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14510.75 Da        Isoelectric Point: 9.7778

>NTDB_id=1099703 ACLQ7P_RS08245 WP_032726157.1 1616227..1616601(+) (comGG) [Bacillus subtilis subsp. subtilis strain JCK-1398]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1099703 ACLQ7P_RS08245 WP_032726157.1 1616227..1616601(+) (comGG) [Bacillus subtilis subsp. subtilis strain JCK-1398]
ATGTACCGTACGAGGGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGAAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96


Multiple sequence alignment