Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   ACM67D_RS02365 Genome accession   NZ_CP181245
Coordinates   451049..451522 (+) Length   157 a.a.
NCBI ID   WP_176549393.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain LNP 16626     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 451592..490155 451049..451522 flank 70


Gene organization within MGE regions


Location: 451049..490155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM67D_RS02365 (ACM67D_02365) pilL 451049..451522 (+) 474 WP_176549393.1 PilX family type IV pilin Machinery gene
  ACM67D_RS02370 (ACM67D_02370) - 451592..451900 (-) 309 WP_047920338.1 AzlD family protein -
  ACM67D_RS02375 (ACM67D_02375) - 451897..452605 (-) 709 Protein_463 AzlC family ABC transporter permease -
  ACM67D_RS02380 (ACM67D_02380) dut 452771..453223 (+) 453 WP_047925987.1 dUTP diphosphatase -
  ACM67D_RS02385 (ACM67D_02385) dapC 453301..454488 (+) 1188 WP_139595900.1 succinyldiaminopimelate transaminase -
  ACM67D_RS02390 (ACM67D_02390) yaaA 454800..455579 (+) 780 WP_123812609.1 peroxide stress protein YaaA -
  ACM67D_RS02405 (ACM67D_02405) - 456110..457303 (+) 1194 WP_010359935.1 tyrosine-type recombinase/integrase -
  ACM67D_RS02410 (ACM67D_02410) - 457659..457928 (-) 270 WP_003687928.1 hypothetical protein -
  ACM67D_RS02415 (ACM67D_02415) - 458123..458806 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  ACM67D_RS02420 (ACM67D_02420) - 459087..459353 (-) 267 Protein_470 hypothetical protein -
  ACM67D_RS02425 (ACM67D_02425) - 459464..459679 (-) 216 WP_003691538.1 hypothetical protein -
  ACM67D_RS02430 (ACM67D_02430) - 459731..460222 (-) 492 WP_017147227.1 siphovirus Gp157 family protein -
  ACM67D_RS02435 (ACM67D_02435) - 460219..460401 (-) 183 WP_003691535.1 hypothetical protein -
  ACM67D_RS02440 (ACM67D_02440) - 460542..461228 (-) 687 WP_033910330.1 phage replication initiation protein, NGO0469 family -
  ACM67D_RS02445 (ACM67D_02445) - 461297..461458 (-) 162 WP_004464809.1 hypothetical protein -
  ACM67D_RS02450 (ACM67D_02450) - 461455..461730 (-) 276 WP_010359972.1 NGO1622 family putative holin -
  ACM67D_RS02455 (ACM67D_02455) - 461883..462215 (-) 333 WP_050154664.1 hypothetical protein -
  ACM67D_RS02460 (ACM67D_02460) - 462357..462632 (-) 276 WP_050302440.1 hypothetical protein -
  ACM67D_RS02465 (ACM67D_02465) - 462629..463105 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  ACM67D_RS02470 (ACM67D_02470) - 463138..463338 (-) 201 WP_003697225.1 hypothetical protein -
  ACM67D_RS02475 (ACM67D_02475) - 463536..463949 (-) 414 WP_003687963.1 hypothetical protein -
  ACM67D_RS02480 (ACM67D_02480) - 463946..464407 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  ACM67D_RS02485 (ACM67D_02485) - 464424..464861 (-) 438 WP_003687967.1 hypothetical protein -
  ACM67D_RS02490 (ACM67D_02490) - 464974..465690 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  ACM67D_RS02495 (ACM67D_02495) - 465765..465995 (+) 231 WP_020997318.1 transcriptional regulator -
  ACM67D_RS02500 (ACM67D_02500) - 466076..466231 (+) 156 WP_003698902.1 hypothetical protein -
  ACM67D_RS02505 (ACM67D_02505) - 466208..466396 (-) 189 WP_003698903.1 hypothetical protein -
  ACM67D_RS02510 (ACM67D_02510) - 466569..466796 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  ACM67D_RS02515 (ACM67D_02515) - 466914..467978 (+) 1065 WP_050154181.1 hypothetical protein -
  ACM67D_RS02520 (ACM67D_02520) - 467975..469336 (+) 1362 WP_139595938.1 DnaB-like helicase C-terminal domain-containing protein -
  ACM67D_RS02525 (ACM67D_02525) - 469353..469601 (+) 249 WP_416192818.1 hypothetical protein -
  ACM67D_RS02530 (ACM67D_02530) - 469677..470132 (+) 456 WP_047924494.1 DUF3310 domain-containing protein -
  ACM67D_RS02535 (ACM67D_02535) - 470156..470305 (+) 150 WP_010951059.1 hypothetical protein -
  ACM67D_RS02540 (ACM67D_02540) - 470335..470616 (+) 282 WP_003689109.1 hypothetical protein -
  ACM67D_RS02545 (ACM67D_02545) - 470607..471044 (+) 438 WP_172760534.1 RusA family crossover junction endodeoxyribonuclease -
  ACM67D_RS02550 (ACM67D_02550) - 471037..471342 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  ACM67D_RS02555 (ACM67D_02555) - 471339..471722 (+) 384 WP_003690918.1 recombination protein NinB -
  ACM67D_RS02560 (ACM67D_02560) - 471713..472231 (+) 519 WP_003693459.1 HNH endonuclease -
  ACM67D_RS02565 (ACM67D_02565) - 472296..472718 (+) 423 WP_003690919.1 hypothetical protein -
  ACM67D_RS02570 (ACM67D_02570) - 472718..473257 (+) 540 WP_003690920.1 hypothetical protein -
  ACM67D_RS02575 (ACM67D_02575) - 473238..474512 (+) 1275 WP_047919159.1 PBSX family phage terminase large subunit -
  ACM67D_RS02580 (ACM67D_02580) - 474497..476764 (+) 2268 WP_225577699.1 hypothetical protein -
  ACM67D_RS02585 (ACM67D_02585) - 477001..478197 (+) 1197 WP_115094017.1 hypothetical protein -
  ACM67D_RS02590 (ACM67D_02590) - 478194..485510 (+) 7317 WP_176549394.1 PLxRFG domain-containing protein -
  ACM67D_RS02595 (ACM67D_02595) - 486136..487431 (+) 1296 WP_003695011.1 DUF4043 family protein -
  ACM67D_RS02600 (ACM67D_02600) - 487486..487959 (+) 474 WP_003687996.1 hypothetical protein -
  ACM67D_RS02605 (ACM67D_02605) - 487965..488450 (+) 486 WP_003687997.1 hypothetical protein -
  ACM67D_RS02610 (ACM67D_02610) - 488447..489121 (+) 675 WP_003687998.1 hypothetical protein -
  ACM67D_RS02615 (ACM67D_02615) - 489112..489273 (+) 162 WP_003687999.1 hypothetical protein -
  ACM67D_RS02620 (ACM67D_02620) - 489310..490155 (-) 846 WP_003701197.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17449.16 Da        Isoelectric Point: 9.7325

>NTDB_id=1099492 ACM67D_RS02365 WP_176549393.1 451049..451522(+) (pilL) [Neisseria gonorrhoeae strain LNP 16626]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTFKSKLGIFVSGYKM
NPKIAKKYSVSVRFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRNAASARVYSDTLSADSGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=1099492 ACM67D_RS02365 WP_176549393.1 451049..451522(+) (pilL) [Neisseria gonorrhoeae strain LNP 16626]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCTTCAAGAGCAAACTGGGAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCG
CTTCTGCCCGGGTCTATTCGGACACCTTGTCCGCAGATAGCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

93.631

100

0.936
  pilX Neisseria meningitidis 8013

85.987

100

0.86

Multiple sequence alignment