Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   ACGHT2_RS09995 Genome accession   NZ_AP031455
Coordinates   1911778..1911918 (+) Length   46 a.a.
NCBI ID   WP_195990863.1    Uniprot ID   -
Organism   Streptococcus pasteurianus strain k46-0107-A9     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 1906778..1916918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACGHT2_RS09945 (K460107A9_18710) - 1906786..1907415 (-) 630 WP_013852267.1 thiamine diphosphokinase -
  ACGHT2_RS09950 (K460107A9_18720) rpe 1907408..1908070 (-) 663 WP_003066548.1 ribulose-phosphate 3-epimerase -
  ACGHT2_RS09955 (K460107A9_18730) rsgA 1908077..1908949 (-) 873 WP_058692505.1 ribosome small subunit-dependent GTPase A -
  ACGHT2_RS09970 (K460107A9_18740) - 1909407..1909607 (-) 201 WP_058692506.1 hypothetical protein -
  ACGHT2_RS09975 (K460107A9_18750) - 1909816..1910157 (-) 342 WP_195990867.1 bacteriocin immunity protein -
  ACGHT2_RS09980 (K460107A9_18760) - 1910208..1910435 (-) 228 WP_048791098.1 hypothetical protein -
  ACGHT2_RS09985 (K460107A9_18770) - 1910708..1911019 (-) 312 WP_048791097.1 bacteriocin immunity protein -
  ACGHT2_RS09990 (K460107A9_18780) - 1911188..1911487 (-) 300 WP_195990865.1 DUF3884 family protein -
  ACGHT2_RS09995 (K460107A9_18790) comC/comC1 1911778..1911918 (+) 141 WP_195990863.1 competence protein Regulator
  ACGHT2_RS10000 (K460107A9_18800) - 1911940..1913247 (-) 1308 WP_270619824.1 sensor histidine kinase -
  ACGHT2_RS10005 (K460107A9_18810) comE/comE1 1913255..1913986 (-) 732 WP_058692509.1 response regulator transcription factor Regulator
  ACGHT2_RS10010 (K460107A9_18820) - 1914003..1914287 (-) 285 WP_003066573.1 LytTR family DNA-binding domain-containing protein -
  ACGHT2_RS10015 (K460107A9_18830) - 1914530..1914730 (-) 201 WP_058692510.1 hypothetical protein -
  ACGHT2_RS10020 (K460107A9_18840) - 1914985..1915998 (-) 1014 WP_003066577.1 hypothetical protein -
  ACGHT2_RS10025 (K460107A9_18850) - 1916170..1916466 (-) 297 WP_003066579.1 bacteriocin immunity protein -
  ACGHT2_RS10030 (K460107A9_18860) - 1916466..1916684 (-) 219 WP_003066580.1 Blp family class II bacteriocin -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5448.36 Da        Isoelectric Point: 9.8988

>NTDB_id=109632 ACGHT2_RS09995 WP_195990863.1 1911778..1911918(+) (comC/comC1) [Streptococcus pasteurianus strain k46-0107-A9]
MMTEKMFKELDQSELEKTIGGKNKDFLIVGPFDWLKNFNNKPKKQT

Nucleotide


Download         Length: 141 bp        

>NTDB_id=109632 ACGHT2_RS09995 WP_195990863.1 1911778..1911918(+) (comC/comC1) [Streptococcus pasteurianus strain k46-0107-A9]
ATGATGACAGAAAAAATGTTTAAAGAGTTAGATCAATCTGAATTAGAGAAAACGATTGGTGGAAAGAATAAGGATTTCTT
AATTGTTGGACCTTTTGATTGGTTGAAAAACTTTAACAACAAGCCTAAAAAACAAACTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

51.111

97.826

0.5

Multiple sequence alignment