Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACMX77_RS13515 Genome accession   NZ_CP180438
Coordinates   2575702..2576085 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain W-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2570702..2581085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMX77_RS13475 (ACMX77_13475) sinI 2571637..2571810 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACMX77_RS13480 (ACMX77_13480) sinR 2571844..2572179 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACMX77_RS13485 (ACMX77_13485) tasA 2572272..2573057 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ACMX77_RS13490 (ACMX77_13490) sipW 2573121..2573693 (-) 573 WP_080030740.1 signal peptidase I SipW -
  ACMX77_RS13495 (ACMX77_13495) tapA 2573677..2574438 (-) 762 WP_047182870.1 amyloid fiber anchoring/assembly protein TapA -
  ACMX77_RS13500 (ACMX77_13500) yqzG 2574708..2575034 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  ACMX77_RS13505 (ACMX77_13505) spoIITA 2575076..2575255 (-) 180 WP_003230176.1 YqzE family protein -
  ACMX77_RS13510 (ACMX77_13510) comGG 2575327..2575701 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACMX77_RS13515 (ACMX77_13515) comGF 2575702..2576085 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  ACMX77_RS13520 (ACMX77_13520) comGE 2576111..2576458 (-) 348 WP_047182872.1 ComG operon protein 5 Machinery gene
  ACMX77_RS13525 (ACMX77_13525) comGD 2576442..2576873 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  ACMX77_RS13530 (ACMX77_13530) comGC 2576863..2577159 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  ACMX77_RS13535 (ACMX77_13535) comGB 2577173..2578210 (-) 1038 WP_047182873.1 comG operon protein ComGB Machinery gene
  ACMX77_RS13540 (ACMX77_13540) comGA 2578197..2579267 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  ACMX77_RS13545 (ACMX77_13545) corA 2579677..2580630 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=1095802 ACMX77_RS13515 WP_015384087.1 2575702..2576085(-) (comGF) [Bacillus subtilis strain W-2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1095802 ACMX77_RS13515 WP_015384087.1 2575702..2576085(-) (comGF) [Bacillus subtilis strain W-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment