Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACMX77_RS13475 Genome accession   NZ_CP180438
Coordinates   2571637..2571810 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain W-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2566637..2576810
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMX77_RS13460 (ACMX77_13460) gcvT 2567436..2568524 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  ACMX77_RS13465 (ACMX77_13465) hepAA 2568966..2570639 (+) 1674 WP_047182869.1 DEAD/DEAH box helicase -
  ACMX77_RS13470 (ACMX77_13470) yqhG 2570660..2571454 (+) 795 WP_003230200.1 YqhG family protein -
  ACMX77_RS13475 (ACMX77_13475) sinI 2571637..2571810 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACMX77_RS13480 (ACMX77_13480) sinR 2571844..2572179 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACMX77_RS13485 (ACMX77_13485) tasA 2572272..2573057 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ACMX77_RS13490 (ACMX77_13490) sipW 2573121..2573693 (-) 573 WP_080030740.1 signal peptidase I SipW -
  ACMX77_RS13495 (ACMX77_13495) tapA 2573677..2574438 (-) 762 WP_047182870.1 amyloid fiber anchoring/assembly protein TapA -
  ACMX77_RS13500 (ACMX77_13500) yqzG 2574708..2575034 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  ACMX77_RS13505 (ACMX77_13505) spoIITA 2575076..2575255 (-) 180 WP_003230176.1 YqzE family protein -
  ACMX77_RS13510 (ACMX77_13510) comGG 2575327..2575701 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACMX77_RS13515 (ACMX77_13515) comGF 2575702..2576085 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  ACMX77_RS13520 (ACMX77_13520) comGE 2576111..2576458 (-) 348 WP_047182872.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1095799 ACMX77_RS13475 WP_003230187.1 2571637..2571810(+) (sinI) [Bacillus subtilis strain W-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1095799 ACMX77_RS13475 WP_003230187.1 2571637..2571810(+) (sinI) [Bacillus subtilis strain W-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment