Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACMX2G_RS04315 Genome accession   NZ_CP180375
Coordinates   846631..846771 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NJN-6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 841631..851771
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMX2G_RS04290 (ACMX2G_04290) - 841971..842354 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACMX2G_RS04295 (ACMX2G_04295) comA 842376..843020 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACMX2G_RS04300 (ACMX2G_04300) comP 843101..845392 (-) 2292 WP_014305719.1 histidine kinase Regulator
  ACMX2G_RS04305 (ACMX2G_04305) comX 845404..845568 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACMX2G_RS04310 (ACMX2G_04310) - 845568..846479 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  ACMX2G_RS04315 (ACMX2G_04315) degQ 846631..846771 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACMX2G_RS04320 (ACMX2G_04320) - 847237..847578 (+) 342 WP_014305721.1 hypothetical protein -
  ACMX2G_RS04325 (ACMX2G_04325) - 847585..848805 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACMX2G_RS04330 (ACMX2G_04330) - 848935..850401 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACMX2G_RS04335 (ACMX2G_04335) - 850419..850970 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACMX2G_RS04340 (ACMX2G_04340) - 851067..851465 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1095467 ACMX2G_RS04315 WP_003152043.1 846631..846771(-) (degQ) [Bacillus velezensis strain NJN-6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1095467 ACMX2G_RS04315 WP_003152043.1 846631..846771(-) (degQ) [Bacillus velezensis strain NJN-6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment