Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACLBKW_RS14835 Genome accession   NZ_CP180232
Coordinates   2866470..2866610 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain Ba     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2861470..2871610
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLBKW_RS14810 (ACLBKW_14810) - 2861735..2862124 (-) 390 WP_017367960.1 hotdog fold thioesterase -
  ACLBKW_RS14815 (ACLBKW_14815) comA 2862148..2862789 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  ACLBKW_RS14820 (ACLBKW_14820) comP 2862870..2865182 (-) 2313 WP_171465713.1 ATP-binding protein Regulator
  ACLBKW_RS14825 (ACLBKW_14825) comX 2865240..2865407 (-) 168 WP_108611760.1 competence pheromone ComX -
  ACLBKW_RS14830 (ACLBKW_14830) - 2865404..2866318 (-) 915 WP_113747034.1 polyprenyl synthetase family protein -
  ACLBKW_RS14835 (ACLBKW_14835) degQ 2866470..2866610 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACLBKW_RS14840 (ACLBKW_14840) - 2867116..2867469 (+) 354 WP_019744042.1 hypothetical protein -
  ACLBKW_RS14845 (ACLBKW_14845) - 2867506..2868732 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  ACLBKW_RS14850 (ACLBKW_14850) - 2868873..2870342 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  ACLBKW_RS14855 (ACLBKW_14855) - 2870360..2870911 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  ACLBKW_RS14860 (ACLBKW_14860) - 2870972..2871379 (-) 408 WP_414834426.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1094696 ACLBKW_RS14835 WP_003213123.1 2866470..2866610(-) (degQ) [Bacillus altitudinis strain Ba]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1094696 ACLBKW_RS14835 WP_003213123.1 2866470..2866610(-) (degQ) [Bacillus altitudinis strain Ba]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment