Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACL9SD_RS17100 Genome accession   NZ_CP178914
Coordinates   3383283..3383423 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain IFST-745     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3378283..3388423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL9SD_RS17075 (ACL9SD_17075) - 3378583..3378972 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  ACL9SD_RS17080 (ACL9SD_17080) comA 3378989..3379627 (-) 639 WP_413944957.1 response regulator transcription factor Regulator
  ACL9SD_RS17085 (ACL9SD_17085) comP 3379714..3382026 (-) 2313 WP_095323674.1 ATP-binding protein Regulator
  ACL9SD_RS17090 (ACL9SD_17090) comX 3382038..3382211 (-) 174 WP_080131484.1 competence pheromone ComX -
  ACL9SD_RS17095 (ACL9SD_17095) - 3382215..3383096 (-) 882 WP_080131485.1 polyprenyl synthetase family protein -
  ACL9SD_RS17100 (ACL9SD_17100) degQ 3383283..3383423 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  ACL9SD_RS17105 (ACL9SD_17105) - 3384035..3384256 (+) 222 WP_229029875.1 hypothetical protein -
  ACL9SD_RS17110 (ACL9SD_17110) - 3384299..3385519 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  ACL9SD_RS17115 (ACL9SD_17115) - 3385697..3387166 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  ACL9SD_RS17120 (ACL9SD_17120) - 3387184..3387735 (-) 552 WP_026580053.1 cysteine hydrolase family protein -
  ACL9SD_RS17125 (ACL9SD_17125) - 3387921..3388322 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=1092410 ACL9SD_RS17100 WP_003184860.1 3383283..3383423(-) (degQ) [Bacillus paralicheniformis strain IFST-745]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1092410 ACL9SD_RS17100 WP_003184860.1 3383283..3383423(-) (degQ) [Bacillus paralicheniformis strain IFST-745]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment