Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACKUFW_RS01975 Genome accession   NZ_CP178610
Coordinates   389204..389323 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain GUMHT p116     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 384204..394323
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKUFW_RS01960 (ACKUFW_01960) - 385816..386499 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACKUFW_RS01965 (ACKUFW_01965) - 386486..387919 (+) 1434 WP_182069772.1 sensor histidine kinase -
  ACKUFW_RS01970 (ACKUFW_01970) rapC 388072..389220 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  ACKUFW_RS01975 (ACKUFW_01975) phrC 389204..389323 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACKUFW_RS01980 (ACKUFW_01980) - 389473..389583 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACKUFW_RS01985 (ACKUFW_01985) - 389663..391027 (-) 1365 WP_020955323.1 aspartate kinase -
  ACKUFW_RS01990 (ACKUFW_01990) ceuB 391441..392394 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  ACKUFW_RS01995 (ACKUFW_01995) - 392384..393331 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  ACKUFW_RS02000 (ACKUFW_02000) - 393325..394083 (+) 759 WP_071392129.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1090448 ACKUFW_RS01975 WP_003156334.1 389204..389323(+) (phrC) [Bacillus velezensis strain GUMHT p116]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1090448 ACKUFW_RS01975 WP_003156334.1 389204..389323(+) (phrC) [Bacillus velezensis strain GUMHT p116]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment