Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACJGE3_RS06615 Genome accession   NZ_CP178562
Coordinates   1445778..1446092 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain JT-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1440778..1451092
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE3_RS06570 (ACJGE3_06570) sinI 1441461..1441634 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJGE3_RS06575 (ACJGE3_06575) sinR 1441668..1442003 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJGE3_RS06580 (ACJGE3_06580) tasA 1442051..1442836 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACJGE3_RS06585 (ACJGE3_06585) sipW 1442900..1443484 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACJGE3_RS06590 (ACJGE3_06590) tapA 1443456..1444127 (-) 672 WP_369614537.1 amyloid fiber anchoring/assembly protein TapA -
  ACJGE3_RS06595 (ACJGE3_06595) - 1444386..1444715 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACJGE3_RS06600 (ACJGE3_06600) - 1444755..1444934 (-) 180 WP_003153093.1 YqzE family protein -
  ACJGE3_RS06605 (ACJGE3_06605) comGG 1444991..1445368 (-) 378 WP_182069279.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJGE3_RS06610 (ACJGE3_06610) comGF 1445369..1445764 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  ACJGE3_RS06615 (ACJGE3_06615) comGE 1445778..1446092 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJGE3_RS06620 (ACJGE3_06620) comGD 1446076..1446513 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJGE3_RS06625 (ACJGE3_06625) comGC 1446503..1446769 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJGE3_RS06630 (ACJGE3_06630) comGB 1446816..1447853 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJGE3_RS06635 (ACJGE3_06635) comGA 1447840..1448910 (-) 1071 WP_369614538.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJGE3_RS06640 (ACJGE3_06640) - 1449102..1450052 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1090157 ACJGE3_RS06615 WP_015388003.1 1445778..1446092(-) (comGE) [Bacillus velezensis strain JT-3]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1090157 ACJGE3_RS06615 WP_015388003.1 1445778..1446092(-) (comGE) [Bacillus velezensis strain JT-3]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAGC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment