Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACJGE3_RS06570 | Genome accession | NZ_CP178562 |
| Coordinates | 1441461..1441634 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JT-3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1436461..1446634
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJGE3_RS06555 (ACJGE3_06555) | gcvT | 1437278..1438378 (-) | 1101 | WP_369614536.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACJGE3_RS06560 (ACJGE3_06560) | - | 1438802..1440472 (+) | 1671 | WP_060562612.1 | DEAD/DEAH box helicase | - |
| ACJGE3_RS06565 (ACJGE3_06565) | - | 1440490..1441284 (+) | 795 | WP_104842681.1 | YqhG family protein | - |
| ACJGE3_RS06570 (ACJGE3_06570) | sinI | 1441461..1441634 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACJGE3_RS06575 (ACJGE3_06575) | sinR | 1441668..1442003 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACJGE3_RS06580 (ACJGE3_06580) | tasA | 1442051..1442836 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACJGE3_RS06585 (ACJGE3_06585) | sipW | 1442900..1443484 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACJGE3_RS06590 (ACJGE3_06590) | tapA | 1443456..1444127 (-) | 672 | WP_369614537.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACJGE3_RS06595 (ACJGE3_06595) | - | 1444386..1444715 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACJGE3_RS06600 (ACJGE3_06600) | - | 1444755..1444934 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACJGE3_RS06605 (ACJGE3_06605) | comGG | 1444991..1445368 (-) | 378 | WP_182069279.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACJGE3_RS06610 (ACJGE3_06610) | comGF | 1445369..1445764 (-) | 396 | WP_077722593.1 | competence type IV pilus minor pilin ComGF | - |
| ACJGE3_RS06615 (ACJGE3_06615) | comGE | 1445778..1446092 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACJGE3_RS06620 (ACJGE3_06620) | comGD | 1446076..1446513 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1090154 ACJGE3_RS06570 WP_003153105.1 1441461..1441634(+) (sinI) [Bacillus velezensis strain JT-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1090154 ACJGE3_RS06570 WP_003153105.1 1441461..1441634(+) (sinI) [Bacillus velezensis strain JT-3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |