Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACJGE3_RS06570 Genome accession   NZ_CP178562
Coordinates   1441461..1441634 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain JT-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1436461..1446634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE3_RS06555 (ACJGE3_06555) gcvT 1437278..1438378 (-) 1101 WP_369614536.1 glycine cleavage system aminomethyltransferase GcvT -
  ACJGE3_RS06560 (ACJGE3_06560) - 1438802..1440472 (+) 1671 WP_060562612.1 DEAD/DEAH box helicase -
  ACJGE3_RS06565 (ACJGE3_06565) - 1440490..1441284 (+) 795 WP_104842681.1 YqhG family protein -
  ACJGE3_RS06570 (ACJGE3_06570) sinI 1441461..1441634 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJGE3_RS06575 (ACJGE3_06575) sinR 1441668..1442003 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJGE3_RS06580 (ACJGE3_06580) tasA 1442051..1442836 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACJGE3_RS06585 (ACJGE3_06585) sipW 1442900..1443484 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACJGE3_RS06590 (ACJGE3_06590) tapA 1443456..1444127 (-) 672 WP_369614537.1 amyloid fiber anchoring/assembly protein TapA -
  ACJGE3_RS06595 (ACJGE3_06595) - 1444386..1444715 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACJGE3_RS06600 (ACJGE3_06600) - 1444755..1444934 (-) 180 WP_003153093.1 YqzE family protein -
  ACJGE3_RS06605 (ACJGE3_06605) comGG 1444991..1445368 (-) 378 WP_182069279.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJGE3_RS06610 (ACJGE3_06610) comGF 1445369..1445764 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  ACJGE3_RS06615 (ACJGE3_06615) comGE 1445778..1446092 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJGE3_RS06620 (ACJGE3_06620) comGD 1446076..1446513 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1090154 ACJGE3_RS06570 WP_003153105.1 1441461..1441634(+) (sinI) [Bacillus velezensis strain JT-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1090154 ACJGE3_RS06570 WP_003153105.1 1441461..1441634(+) (sinI) [Bacillus velezensis strain JT-3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment