Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACLZ2J_RS13185 Genome accession   NZ_CP178514
Coordinates   2524072..2524455 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain BS18-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2519072..2529455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLZ2J_RS13145 sinI 2520006..2520179 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACLZ2J_RS13150 sinR 2520213..2520548 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACLZ2J_RS13155 tasA 2520641..2521426 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ACLZ2J_RS13160 sipW 2521490..2522062 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ACLZ2J_RS13165 tapA 2522046..2522807 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  ACLZ2J_RS13170 yqzG 2523079..2523405 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACLZ2J_RS13175 spoIITA 2523447..2523626 (-) 180 WP_003230176.1 YqzE family protein -
  ACLZ2J_RS13180 comGG 2523697..2524071 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ACLZ2J_RS13185 comGF 2524072..2524455 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ACLZ2J_RS13190 comGE 2524481..2524828 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ACLZ2J_RS13195 comGD 2524812..2525243 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ACLZ2J_RS13200 comGC 2525233..2525529 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACLZ2J_RS13205 comGB 2525543..2526580 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ACLZ2J_RS13210 comGA 2526567..2527637 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ACLZ2J_RS13215 corA 2528049..2529002 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=1089810 ACLZ2J_RS13185 WP_003230168.1 2524072..2524455(-) (comGF) [Bacillus subtilis strain BS18-1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1089810 ACLZ2J_RS13185 WP_003230168.1 2524072..2524455(-) (comGF) [Bacillus subtilis strain BS18-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment