Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACLZ2J_RS13145 Genome accession   NZ_CP178514
Coordinates   2520006..2520179 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BS18-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2515006..2525179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLZ2J_RS13130 gcvT 2515805..2516893 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  ACLZ2J_RS13135 hepAA 2517335..2519008 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  ACLZ2J_RS13140 yqhG 2519029..2519823 (+) 795 WP_003230200.1 YqhG family protein -
  ACLZ2J_RS13145 sinI 2520006..2520179 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACLZ2J_RS13150 sinR 2520213..2520548 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACLZ2J_RS13155 tasA 2520641..2521426 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ACLZ2J_RS13160 sipW 2521490..2522062 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ACLZ2J_RS13165 tapA 2522046..2522807 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  ACLZ2J_RS13170 yqzG 2523079..2523405 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACLZ2J_RS13175 spoIITA 2523447..2523626 (-) 180 WP_003230176.1 YqzE family protein -
  ACLZ2J_RS13180 comGG 2523697..2524071 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ACLZ2J_RS13185 comGF 2524072..2524455 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ACLZ2J_RS13190 comGE 2524481..2524828 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1089807 ACLZ2J_RS13145 WP_003230187.1 2520006..2520179(+) (sinI) [Bacillus subtilis strain BS18-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1089807 ACLZ2J_RS13145 WP_003230187.1 2520006..2520179(+) (sinI) [Bacillus subtilis strain BS18-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment