Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACLNGX_RS15005 Genome accession   NZ_CP178374
Coordinates   3095160..3095300 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 2023     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3090160..3100300
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLNGX_RS14980 (ACLNGX_14980) - 3090500..3090883 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  ACLNGX_RS14985 (ACLNGX_14985) comA 3090905..3091549 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACLNGX_RS14990 (ACLNGX_14990) comP 3091630..3093921 (-) 2292 WP_412838366.1 histidine kinase Regulator
  ACLNGX_RS14995 (ACLNGX_14995) comX 3093933..3094097 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACLNGX_RS15000 (ACLNGX_15000) - 3094097..3095008 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  ACLNGX_RS15005 (ACLNGX_15005) degQ 3095160..3095300 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACLNGX_RS15010 (ACLNGX_15010) - 3095765..3096106 (+) 342 WP_014305721.1 hypothetical protein -
  ACLNGX_RS15015 (ACLNGX_15015) - 3096113..3097333 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACLNGX_RS15020 (ACLNGX_15020) - 3097463..3098929 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACLNGX_RS15025 (ACLNGX_15025) - 3098947..3099498 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  ACLNGX_RS15030 (ACLNGX_15030) - 3099595..3099993 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1089176 ACLNGX_RS15005 WP_003152043.1 3095160..3095300(-) (degQ) [Bacillus velezensis strain 2023]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1089176 ACLNGX_RS15005 WP_003152043.1 3095160..3095300(-) (degQ) [Bacillus velezensis strain 2023]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment