Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   ACLII2_RS15935 Genome accession   NZ_CP178213
Coordinates   3009638..3009829 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain BM107     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 3004638..3014829
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLII2_RS15910 appD 3004963..3005949 (-) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -
  ACLII2_RS15915 yjaZ 3006141..3006926 (-) 786 WP_003232967.1 DUF2268 domain-containing protein -
  ACLII2_RS15920 fabF 3007002..3008243 (-) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  ACLII2_RS15925 fabH 3008266..3009204 (-) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  ACLII2_RS15930 yjzB 3009369..3009608 (+) 240 WP_003232972.1 spore coat protein YjzB -
  ACLII2_RS15935 comZ 3009638..3009829 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  ACLII2_RS15940 med 3009844..3010797 (-) 954 WP_003245494.1 transcriptional regulator Med Regulator
  ACLII2_RS15945 - 3010888..3011445 (-) 558 WP_003232974.1 hypothetical protein -
  ACLII2_RS15950 - 3011527..3012261 (-) 735 WP_003245223.1 hypothetical protein -
  ACLII2_RS15955 yjzD 3012510..3012695 (+) 186 WP_003245236.1 YjzD family protein -
  ACLII2_RS15960 yjzC 3012741..3012920 (-) 180 WP_003245356.1 YjzC family protein -
  ACLII2_RS15965 argF 3013006..3013965 (-) 960 WP_003232980.1 ornithine carbamoyltransferase -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=1088321 ACLII2_RS15935 WP_003224559.1 3009638..3009829(-) (comZ) [Bacillus subtilis subsp. subtilis strain BM107]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=1088321 ACLII2_RS15935 WP_003224559.1 3009638..3009829(-) (comZ) [Bacillus subtilis subsp. subtilis strain BM107]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment