Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ACLII2_RS04955 Genome accession   NZ_CP178213
Coordinates   961404..961571 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis strain BM107     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 956404..966571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLII2_RS04925 pncB 956549..958021 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACLII2_RS04930 pdeH 958158..959387 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACLII2_RS04935 - 959363..959731 (-) 369 WP_003243784.1 hypothetical protein -
  ACLII2_RS04940 - 959845..959970 (-) 126 WP_003228793.1 hypothetical protein -
  ACLII2_RS04945 degQ 960192..960332 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLII2_RS04950 comQ 960517..961416 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACLII2_RS04955 comX 961404..961571 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACLII2_RS04960 comP 961586..963894 (+) 2309 Protein_985 two-component system sensor histidine kinase ComP -
  ACLII2_RS04965 comA 963975..964619 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLII2_RS04970 yuxO 964638..965018 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  ACLII2_RS04975 mnhG 965057..965431 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  ACLII2_RS04980 mrpF 965415..965699 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ACLII2_RS04985 mrpE 965699..966175 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1088280 ACLII2_RS04955 WP_003242801.1 961404..961571(+) (comX) [Bacillus subtilis subsp. subtilis strain BM107]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1088280 ACLII2_RS04955 WP_003242801.1 961404..961571(+) (comX) [Bacillus subtilis subsp. subtilis strain BM107]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment