Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACLF6N_RS16615 Genome accession   NZ_CP177279
Coordinates   3072554..3072694 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KFRI-P74     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3067554..3077694
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLF6N_RS16590 (ACLF6N_16590) yuxO 3067831..3068211 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  ACLF6N_RS16595 (ACLF6N_16595) comA 3068230..3068874 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLF6N_RS16600 (ACLF6N_16600) comP 3068955..3071267 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  ACLF6N_RS16605 (ACLF6N_16605) comX 3071283..3071504 (-) 222 WP_014480704.1 competence pheromone ComX -
  ACLF6N_RS16610 (ACLF6N_16610) - 3071506..3072369 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  ACLF6N_RS16615 (ACLF6N_16615) degQ 3072554..3072694 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLF6N_RS16620 (ACLF6N_16620) - 3072916..3073041 (+) 126 WP_003228793.1 hypothetical protein -
  ACLF6N_RS16625 (ACLF6N_16625) - 3073156..3073524 (+) 369 WP_046381300.1 hypothetical protein -
  ACLF6N_RS16630 (ACLF6N_16630) pdeH 3073500..3074729 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  ACLF6N_RS16635 (ACLF6N_16635) pncB 3074865..3076337 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACLF6N_RS16640 (ACLF6N_16640) pncA 3076353..3076904 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  ACLF6N_RS16645 (ACLF6N_16645) yueI 3077001..3077399 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1086569 ACLF6N_RS16615 WP_003220708.1 3072554..3072694(-) (degQ) [Bacillus subtilis strain KFRI-P74]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1086569 ACLF6N_RS16615 WP_003220708.1 3072554..3072694(-) (degQ) [Bacillus subtilis strain KFRI-P74]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment