Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACLF6N_RS13060 Genome accession   NZ_CP177279
Coordinates   2407813..2407986 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain KFRI-P74     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2402813..2412986
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLF6N_RS13045 (ACLF6N_13045) gcvT 2403612..2404700 (-) 1089 WP_129134000.1 glycine cleavage system aminomethyltransferase GcvT -
  ACLF6N_RS13050 (ACLF6N_13050) hepAA 2405142..2406815 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  ACLF6N_RS13055 (ACLF6N_13055) yqhG 2406836..2407630 (+) 795 WP_014480249.1 YqhG family protein -
  ACLF6N_RS13060 (ACLF6N_13060) sinI 2407813..2407986 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACLF6N_RS13065 (ACLF6N_13065) sinR 2408020..2408355 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACLF6N_RS13070 (ACLF6N_13070) tasA 2408448..2409233 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ACLF6N_RS13075 (ACLF6N_13075) sipW 2409298..2409870 (-) 573 WP_129134142.1 signal peptidase I SipW -
  ACLF6N_RS13080 (ACLF6N_13080) tapA 2409854..2410615 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ACLF6N_RS13085 (ACLF6N_13085) yqzG 2410887..2411213 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACLF6N_RS13090 (ACLF6N_13090) spoIITA 2411255..2411434 (-) 180 WP_029726723.1 YqzE family protein -
  ACLF6N_RS13095 (ACLF6N_13095) comGG 2411506..2411880 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACLF6N_RS13100 (ACLF6N_13100) comGF 2411881..2412264 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ACLF6N_RS13105 (ACLF6N_13105) comGE 2412290..2412637 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1086545 ACLF6N_RS13060 WP_003230187.1 2407813..2407986(+) (sinI) [Bacillus subtilis strain KFRI-P74]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1086545 ACLF6N_RS13060 WP_003230187.1 2407813..2407986(+) (sinI) [Bacillus subtilis strain KFRI-P74]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment