Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACK2WG_RS15960 Genome accession   NZ_CP176536
Coordinates   3106954..3107094 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii strain 29-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3101954..3112094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK2WG_RS15935 (ACK2WG_15935) - 3102308..3102688 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  ACK2WG_RS15940 (ACK2WG_15940) comA 3102704..3103348 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACK2WG_RS15945 (ACK2WG_15945) comP 3103429..3105726 (-) 2298 WP_409509145.1 histidine kinase Regulator
  ACK2WG_RS15950 (ACK2WG_15950) comX 3105734..3105895 (-) 162 WP_010331692.1 competence pheromone ComX -
  ACK2WG_RS15955 (ACK2WG_15955) - 3105909..3106769 (-) 861 WP_268454381.1 polyprenyl synthetase family protein -
  ACK2WG_RS15960 (ACK2WG_15960) degQ 3106954..3107094 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACK2WG_RS15965 (ACK2WG_15965) - 3107316..3107441 (+) 126 WP_014114985.1 hypothetical protein -
  ACK2WG_RS15970 (ACK2WG_15970) - 3107556..3107924 (+) 369 WP_014114986.1 hypothetical protein -
  ACK2WG_RS15975 (ACK2WG_15975) pdeH 3107900..3109129 (-) 1230 WP_014114987.1 cyclic di-GMP phosphodiesterase -
  ACK2WG_RS15980 (ACK2WG_15980) - 3109265..3110737 (-) 1473 WP_014114988.1 nicotinate phosphoribosyltransferase -
  ACK2WG_RS15985 (ACK2WG_15985) - 3110753..3111304 (-) 552 WP_003220692.1 cysteine hydrolase family protein -
  ACK2WG_RS15990 (ACK2WG_15990) - 3111401..3111799 (-) 399 WP_014114990.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1080805 ACK2WG_RS15960 WP_003220708.1 3106954..3107094(-) (degQ) [Bacillus spizizenii strain 29-4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1080805 ACK2WG_RS15960 WP_003220708.1 3106954..3107094(-) (degQ) [Bacillus spizizenii strain 29-4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment