Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJX3V_RS14915 Genome accession   NZ_CP176523
Coordinates   3028035..3028175 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain MEPW12     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3023035..3033175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJX3V_RS14895 - 3023332..3023715 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACJX3V_RS14900 comA 3023737..3024381 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACJX3V_RS14905 comP 3024462..3026765 (-) 2304 WP_003152050.1 histidine kinase Regulator
  ACJX3V_RS14910 comQ 3026918..3027850 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACJX3V_RS14915 degQ 3028035..3028175 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACJX3V_RS14920 - 3028641..3028982 (+) 342 WP_046560014.1 hypothetical protein -
  ACJX3V_RS14925 - 3028989..3030209 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACJX3V_RS14930 - 3030339..3031805 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACJX3V_RS14935 - 3031823..3032374 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACJX3V_RS14940 - 3032471..3032869 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1080635 ACJX3V_RS14915 WP_003152043.1 3028035..3028175(-) (degQ) [Bacillus amyloliquefaciens strain MEPW12]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1080635 ACJX3V_RS14915 WP_003152043.1 3028035..3028175(-) (degQ) [Bacillus amyloliquefaciens strain MEPW12]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment