Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACKPXQ_RS14920 Genome accession   NZ_CP176038
Coordinates   3039668..3039808 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain A4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3034668..3044808
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKPXQ_RS14900 (ACKPXQ_14900) - 3034965..3035348 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACKPXQ_RS14905 (ACKPXQ_14905) comA 3035370..3036014 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACKPXQ_RS14910 (ACKPXQ_14910) comP 3036095..3038398 (-) 2304 WP_021495364.1 histidine kinase Regulator
  ACKPXQ_RS14915 (ACKPXQ_14915) comQ 3038524..3039483 (-) 960 WP_233662477.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACKPXQ_RS14920 (ACKPXQ_14920) degQ 3039668..3039808 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACKPXQ_RS14925 (ACKPXQ_14925) - 3040274..3040615 (+) 342 WP_007613435.1 hypothetical protein -
  ACKPXQ_RS14930 (ACKPXQ_14930) - 3040622..3041845 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  ACKPXQ_RS14935 (ACKPXQ_14935) - 3041975..3043441 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACKPXQ_RS14940 (ACKPXQ_14940) - 3043459..3044010 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACKPXQ_RS14945 (ACKPXQ_14945) - 3044107..3044505 (-) 399 WP_182071956.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1079538 ACKPXQ_RS14920 WP_003152043.1 3039668..3039808(-) (degQ) [Bacillus velezensis strain A4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1079538 ACKPXQ_RS14920 WP_003152043.1 3039668..3039808(-) (degQ) [Bacillus velezensis strain A4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment