Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACJJTF_RS12030 Genome accession   NZ_CP175908
Coordinates   2481592..2481969 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain SJ22     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2476592..2486969
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJJTF_RS11990 (ACJJTF_11990) - 2477090..2477884 (+) 795 WP_007408330.1 YqhG family protein -
  ACJJTF_RS11995 (ACJJTF_11995) sinI 2478061..2478234 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJJTF_RS12000 (ACJJTF_12000) sinR 2478268..2478603 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJJTF_RS12005 (ACJJTF_12005) tasA 2478651..2479436 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACJJTF_RS12010 (ACJJTF_12010) sipW 2479501..2480085 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACJJTF_RS12015 (ACJJTF_12015) tapA 2480057..2480728 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  ACJJTF_RS12020 (ACJJTF_12020) - 2480987..2481316 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACJJTF_RS12025 (ACJJTF_12025) - 2481356..2481535 (-) 180 WP_003153093.1 YqzE family protein -
  ACJJTF_RS12030 (ACJJTF_12030) comGG 2481592..2481969 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJJTF_RS12035 (ACJJTF_12035) comGF 2481970..2482470 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  ACJJTF_RS12040 (ACJJTF_12040) comGE 2482379..2482693 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  ACJJTF_RS12045 (ACJJTF_12045) comGD 2482677..2483114 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJJTF_RS12050 (ACJJTF_12050) comGC 2483104..2483412 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJJTF_RS12055 (ACJJTF_12055) comGB 2483417..2484454 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJJTF_RS12060 (ACJJTF_12060) comGA 2484441..2485511 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJJTF_RS12065 (ACJJTF_12065) - 2485704..2486654 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=1079066 ACJJTF_RS12030 WP_015417814.1 2481592..2481969(-) (comGG) [Bacillus velezensis strain SJ22]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1079066 ACJJTF_RS12030 WP_015417814.1 2481592..2481969(-) (comGG) [Bacillus velezensis strain SJ22]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment