Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACJJTF_RS11995 | Genome accession | NZ_CP175908 |
| Coordinates | 2478061..2478234 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SJ22 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2473061..2483234
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJJTF_RS11980 (ACJJTF_11980) | gcvT | 2473874..2474974 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACJJTF_RS11985 (ACJJTF_11985) | - | 2475398..2477068 (+) | 1671 | WP_015417810.1 | DEAD/DEAH box helicase | - |
| ACJJTF_RS11990 (ACJJTF_11990) | - | 2477090..2477884 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACJJTF_RS11995 (ACJJTF_11995) | sinI | 2478061..2478234 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACJJTF_RS12000 (ACJJTF_12000) | sinR | 2478268..2478603 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACJJTF_RS12005 (ACJJTF_12005) | tasA | 2478651..2479436 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACJJTF_RS12010 (ACJJTF_12010) | sipW | 2479501..2480085 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACJJTF_RS12015 (ACJJTF_12015) | tapA | 2480057..2480728 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACJJTF_RS12020 (ACJJTF_12020) | - | 2480987..2481316 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACJJTF_RS12025 (ACJJTF_12025) | - | 2481356..2481535 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACJJTF_RS12030 (ACJJTF_12030) | comGG | 2481592..2481969 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACJJTF_RS12035 (ACJJTF_12035) | comGF | 2481970..2482470 (-) | 501 | WP_258548905.1 | competence type IV pilus minor pilin ComGF | - |
| ACJJTF_RS12040 (ACJJTF_12040) | comGE | 2482379..2482693 (-) | 315 | WP_031378943.1 | competence type IV pilus minor pilin ComGE | - |
| ACJJTF_RS12045 (ACJJTF_12045) | comGD | 2482677..2483114 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1079064 ACJJTF_RS11995 WP_003153105.1 2478061..2478234(+) (sinI) [Bacillus velezensis strain SJ22]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1079064 ACJJTF_RS11995 WP_003153105.1 2478061..2478234(+) (sinI) [Bacillus velezensis strain SJ22]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |