Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACJJTF_RS11995 Genome accession   NZ_CP175908
Coordinates   2478061..2478234 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SJ22     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2473061..2483234
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJJTF_RS11980 (ACJJTF_11980) gcvT 2473874..2474974 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  ACJJTF_RS11985 (ACJJTF_11985) - 2475398..2477068 (+) 1671 WP_015417810.1 DEAD/DEAH box helicase -
  ACJJTF_RS11990 (ACJJTF_11990) - 2477090..2477884 (+) 795 WP_007408330.1 YqhG family protein -
  ACJJTF_RS11995 (ACJJTF_11995) sinI 2478061..2478234 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJJTF_RS12000 (ACJJTF_12000) sinR 2478268..2478603 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJJTF_RS12005 (ACJJTF_12005) tasA 2478651..2479436 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACJJTF_RS12010 (ACJJTF_12010) sipW 2479501..2480085 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACJJTF_RS12015 (ACJJTF_12015) tapA 2480057..2480728 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  ACJJTF_RS12020 (ACJJTF_12020) - 2480987..2481316 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACJJTF_RS12025 (ACJJTF_12025) - 2481356..2481535 (-) 180 WP_003153093.1 YqzE family protein -
  ACJJTF_RS12030 (ACJJTF_12030) comGG 2481592..2481969 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJJTF_RS12035 (ACJJTF_12035) comGF 2481970..2482470 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  ACJJTF_RS12040 (ACJJTF_12040) comGE 2482379..2482693 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  ACJJTF_RS12045 (ACJJTF_12045) comGD 2482677..2483114 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1079064 ACJJTF_RS11995 WP_003153105.1 2478061..2478234(+) (sinI) [Bacillus velezensis strain SJ22]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1079064 ACJJTF_RS11995 WP_003153105.1 2478061..2478234(+) (sinI) [Bacillus velezensis strain SJ22]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment