Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACKFA7_RS14575 Genome accession   NZ_CP175553
Coordinates   3015983..3016123 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain 4-9-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3010983..3021123
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKFA7_RS14550 (ACKFA7_14550) - 3011323..3011706 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACKFA7_RS14555 (ACKFA7_14555) comA 3011728..3012372 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACKFA7_RS14560 (ACKFA7_14560) comP 3012453..3014744 (-) 2292 WP_038459663.1 histidine kinase Regulator
  ACKFA7_RS14565 (ACKFA7_14565) comX 3014756..3014920 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACKFA7_RS14570 (ACKFA7_14570) - 3014920..3015831 (-) 912 WP_079891857.1 polyprenyl synthetase family protein -
  ACKFA7_RS14575 (ACKFA7_14575) degQ 3015983..3016123 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACKFA7_RS14580 (ACKFA7_14580) - 3016589..3016930 (+) 342 WP_038459666.1 hypothetical protein -
  ACKFA7_RS14585 (ACKFA7_14585) - 3016937..3018160 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  ACKFA7_RS14590 (ACKFA7_14590) - 3018290..3019756 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACKFA7_RS14595 (ACKFA7_14595) - 3019774..3020325 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACKFA7_RS14600 (ACKFA7_14600) - 3020422..3020820 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1078167 ACKFA7_RS14575 WP_003152043.1 3015983..3016123(-) (degQ) [Bacillus amyloliquefaciens strain 4-9-2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1078167 ACKFA7_RS14575 WP_003152043.1 3015983..3016123(-) (degQ) [Bacillus amyloliquefaciens strain 4-9-2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment