Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJED4_RS07105 Genome accession   NZ_CP174518
Coordinates   1433428..1433568 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain G03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1428428..1438568
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJED4_RS07080 - 1428659..1429066 (+) 408 WP_007500468.1 YueI family protein -
  ACJED4_RS07085 - 1429127..1429678 (+) 552 WP_025207909.1 cysteine hydrolase family protein -
  ACJED4_RS07090 - 1429756..1431165 (+) 1410 WP_407969082.1 nicotinate phosphoribosyltransferase -
  ACJED4_RS07095 - 1431306..1432532 (+) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  ACJED4_RS07100 - 1432569..1432922 (-) 354 WP_017358939.1 hypothetical protein -
  ACJED4_RS07105 degQ 1433428..1433568 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACJED4_RS07110 - 1433720..1434634 (+) 915 WP_108611759.1 polyprenyl synthetase family protein -
  ACJED4_RS07115 comX 1434631..1434798 (+) 168 WP_108611760.1 competence pheromone ComX -
  ACJED4_RS07120 comP 1434856..1437168 (+) 2313 WP_109718413.1 ATP-binding protein Regulator
  ACJED4_RS07125 comA 1437249..1437890 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  ACJED4_RS07130 - 1437914..1438303 (+) 390 WP_008345855.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1077641 ACJED4_RS07105 WP_003213123.1 1433428..1433568(+) (degQ) [Bacillus altitudinis strain G03]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1077641 ACJED4_RS07105 WP_003213123.1 1433428..1433568(+) (degQ) [Bacillus altitudinis strain G03]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment