Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACIU4M_RS05510 Genome accession   NZ_CP174375
Coordinates   986524..986664 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain SF5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 981524..991664
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACIU4M_RS05485 (ACIU4M_05485) - 981858..982247 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  ACIU4M_RS05490 (ACIU4M_05490) comA 982271..982912 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  ACIU4M_RS05495 (ACIU4M_05495) comP 982993..985284 (-) 2292 WP_135009734.1 ATP-binding protein Regulator
  ACIU4M_RS05500 (ACIU4M_05500) comX 985298..985471 (-) 174 WP_135009732.1 competence pheromone ComX -
  ACIU4M_RS05505 (ACIU4M_05505) - 985449..986372 (-) 924 WP_135009731.1 polyprenyl synthetase family protein -
  ACIU4M_RS05510 (ACIU4M_05510) degQ 986524..986664 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACIU4M_RS05515 (ACIU4M_05515) - 987170..987523 (+) 354 WP_017367963.1 hypothetical protein -
  ACIU4M_RS05520 (ACIU4M_05520) - 987560..988786 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  ACIU4M_RS05525 (ACIU4M_05525) - 988927..990396 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  ACIU4M_RS05530 (ACIU4M_05530) - 990414..990965 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  ACIU4M_RS05535 (ACIU4M_05535) - 991026..991433 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1076964 ACIU4M_RS05510 WP_003213123.1 986524..986664(-) (degQ) [Bacillus altitudinis strain SF5]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1076964 ACIU4M_RS05510 WP_003213123.1 986524..986664(-) (degQ) [Bacillus altitudinis strain SF5]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment