Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   AABJ90_RS14695 Genome accession   NZ_AP028964
Coordinates   2879722..2879913 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis strain NA05 = NBRC 116153     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 2874722..2884913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ90_RS14670 (BsubNA05_28510) appD 2875047..2876033 (-) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -
  AABJ90_RS14675 (BsubNA05_28520) yjaZ 2876225..2877010 (-) 786 WP_134982187.1 DUF2268 domain-containing protein -
  AABJ90_RS14680 (BsubNA05_28530) fabF 2877086..2878327 (-) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  AABJ90_RS14685 (BsubNA05_28540) fabH 2878350..2879288 (-) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  AABJ90_RS14690 (BsubNA05_28550) yjzB 2879453..2879692 (+) 240 WP_003232972.1 spore coat protein YjzB -
  AABJ90_RS14695 (BsubNA05_28560) comZ 2879722..2879913 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  AABJ90_RS14700 (BsubNA05_28570) med 2879928..2880881 (-) 954 WP_014476425.1 transcriptional regulator Med Regulator
  AABJ90_RS14705 (BsubNA05_28580) - 2880971..2881528 (-) 558 WP_015252365.1 hypothetical protein -
  AABJ90_RS14710 (BsubNA05_28590) - 2881610..2882344 (-) 735 WP_003245223.1 hypothetical protein -
  AABJ90_RS14715 (BsubNA05_28600) yjzD 2882593..2882778 (+) 186 WP_003245236.1 DUF2929 domain-containing protein -
  AABJ90_RS14720 (BsubNA05_28610) yjzC 2882824..2883003 (-) 180 WP_003245356.1 YjzC family protein -
  AABJ90_RS14725 (BsubNA05_28620) argF 2883089..2884048 (-) 960 WP_153952064.1 ornithine carbamoyltransferase -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=107606 AABJ90_RS14695 WP_003224559.1 2879722..2879913(-) (comZ) [Bacillus subtilis strain NA05 = NBRC 116153]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=107606 AABJ90_RS14695 WP_003224559.1 2879722..2879913(-) (comZ) [Bacillus subtilis strain NA05 = NBRC 116153]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment