Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AABJ90_RS04940 Genome accession   NZ_AP028964
Coordinates   977299..977439 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NA05 = NBRC 116153     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 972299..982439
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ90_RS04910 (BsubNA05_09620) yueI 972592..972990 (+) 399 WP_015251331.1 YueI family protein -
  AABJ90_RS04915 (BsubNA05_09630) pncA 973087..973638 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AABJ90_RS04920 (BsubNA05_09640) pncB 973654..975126 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AABJ90_RS04925 (BsubNA05_09650) pdeH 975263..976492 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AABJ90_RS04930 (BsubNA05_09660) - 976468..976836 (-) 369 WP_338382513.1 hypothetical protein -
  AABJ90_RS04935 - 976952..977077 (-) 126 WP_003228793.1 hypothetical protein -
  AABJ90_RS04940 (BsubNA05_09670) degQ 977299..977439 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AABJ90_RS04945 (BsubNA05_09680) - 977624..978487 (+) 864 WP_032722437.1 polyprenyl synthetase family protein -
  AABJ90_RS04950 (BsubNA05_09690) comX 978489..978710 (+) 222 WP_014480704.1 competence pheromone ComX -
  AABJ90_RS04955 (BsubNA05_09700) comP 978726..981038 (+) 2313 WP_326149885.1 histidine kinase Regulator
  AABJ90_RS04960 (BsubNA05_09710) comA 981119..981763 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AABJ90_RS04965 (BsubNA05_09720) yuxO 981782..982162 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=107563 AABJ90_RS04940 WP_003220708.1 977299..977439(+) (degQ) [Bacillus subtilis strain NA05 = NBRC 116153]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=107563 AABJ90_RS04940 WP_003220708.1 977299..977439(+) (degQ) [Bacillus subtilis strain NA05 = NBRC 116153]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment