Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACJA24_RS11785 Genome accession   NZ_CP174198
Coordinates   2439905..2440342 (-) Length   145 a.a.
NCBI ID   WP_014305413.1    Uniprot ID   -
Organism   Bacillus velezensis strain LQ-03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434905..2445342
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJA24_RS11735 sinI 2435290..2435463 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJA24_RS11740 sinR 2435497..2435832 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJA24_RS11745 tasA 2435880..2436665 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACJA24_RS11750 sipW 2436729..2437313 (-) 585 WP_014305408.1 signal peptidase I SipW -
  ACJA24_RS11755 tapA 2437285..2437956 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  ACJA24_RS11760 - 2438215..2438544 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACJA24_RS11765 - 2438584..2438763 (-) 180 WP_003153093.1 YqzE family protein -
  ACJA24_RS11770 comGG 2438820..2439197 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJA24_RS11775 comGF 2439198..2439593 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACJA24_RS11780 comGE 2439607..2439921 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJA24_RS11785 comGD 2439905..2440342 (-) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJA24_RS11790 comGC 2440332..2440640 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJA24_RS11795 comGB 2440645..2441682 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJA24_RS11800 comGA 2441669..2442739 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJA24_RS11805 - 2442931..2443881 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  ACJA24_RS11810 - 2444027..2445328 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16310.83 Da        Isoelectric Point: 10.3725

>NTDB_id=1074921 ACJA24_RS11785 WP_014305413.1 2439905..2440342(-) (comGD) [Bacillus velezensis strain LQ-03]
MNNNRRTENGFTLLESLVVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPREHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1074921 ACJA24_RS11785 WP_014305413.1 2439905..2440342(-) (comGD) [Bacillus velezensis strain LQ-03]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAGAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552


Multiple sequence alignment