Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACJA24_RS11735 Genome accession   NZ_CP174198
Coordinates   2435290..2435463 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LQ-03     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430290..2440463
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJA24_RS11720 gcvT 2431108..2432208 (-) 1101 WP_406795298.1 glycine cleavage system aminomethyltransferase GcvT -
  ACJA24_RS11725 - 2432631..2434301 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACJA24_RS11730 - 2434319..2435113 (+) 795 WP_014305407.1 YqhG family protein -
  ACJA24_RS11735 sinI 2435290..2435463 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJA24_RS11740 sinR 2435497..2435832 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJA24_RS11745 tasA 2435880..2436665 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACJA24_RS11750 sipW 2436729..2437313 (-) 585 WP_014305408.1 signal peptidase I SipW -
  ACJA24_RS11755 tapA 2437285..2437956 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  ACJA24_RS11760 - 2438215..2438544 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACJA24_RS11765 - 2438584..2438763 (-) 180 WP_003153093.1 YqzE family protein -
  ACJA24_RS11770 comGG 2438820..2439197 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJA24_RS11775 comGF 2439198..2439593 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACJA24_RS11780 comGE 2439607..2439921 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJA24_RS11785 comGD 2439905..2440342 (-) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1074917 ACJA24_RS11735 WP_003153105.1 2435290..2435463(+) (sinI) [Bacillus velezensis strain LQ-03]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1074917 ACJA24_RS11735 WP_003153105.1 2435290..2435463(+) (sinI) [Bacillus velezensis strain LQ-03]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment