Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACJA24_RS11735 | Genome accession | NZ_CP174198 |
| Coordinates | 2435290..2435463 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LQ-03 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2430290..2440463
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJA24_RS11720 | gcvT | 2431108..2432208 (-) | 1101 | WP_406795298.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACJA24_RS11725 | - | 2432631..2434301 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACJA24_RS11730 | - | 2434319..2435113 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| ACJA24_RS11735 | sinI | 2435290..2435463 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACJA24_RS11740 | sinR | 2435497..2435832 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACJA24_RS11745 | tasA | 2435880..2436665 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACJA24_RS11750 | sipW | 2436729..2437313 (-) | 585 | WP_014305408.1 | signal peptidase I SipW | - |
| ACJA24_RS11755 | tapA | 2437285..2437956 (-) | 672 | WP_014305409.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACJA24_RS11760 | - | 2438215..2438544 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACJA24_RS11765 | - | 2438584..2438763 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACJA24_RS11770 | comGG | 2438820..2439197 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACJA24_RS11775 | comGF | 2439198..2439593 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ACJA24_RS11780 | comGE | 2439607..2439921 (-) | 315 | WP_041481885.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACJA24_RS11785 | comGD | 2439905..2440342 (-) | 438 | WP_014305413.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1074917 ACJA24_RS11735 WP_003153105.1 2435290..2435463(+) (sinI) [Bacillus velezensis strain LQ-03]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1074917 ACJA24_RS11735 WP_003153105.1 2435290..2435463(+) (sinI) [Bacillus velezensis strain LQ-03]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |