Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACCO34_RS15935 Genome accession   NZ_CP174160
Coordinates   3146886..3147026 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SMT-24     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3141886..3152026
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO34_RS15915 - 3142183..3142566 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACCO34_RS15920 comA 3142588..3143232 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACCO34_RS15925 comP 3143313..3145616 (-) 2304 WP_003152050.1 histidine kinase Regulator
  ACCO34_RS15930 comQ 3145769..3146701 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACCO34_RS15935 degQ 3146886..3147026 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACCO34_RS15940 - 3147492..3147833 (+) 342 WP_014305721.1 hypothetical protein -
  ACCO34_RS15945 - 3147840..3149060 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACCO34_RS15950 - 3149190..3150656 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACCO34_RS15955 - 3150674..3151225 (-) 552 WP_052586496.1 cysteine hydrolase family protein -
  ACCO34_RS15960 - 3151322..3151720 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1074780 ACCO34_RS15935 WP_003152043.1 3146886..3147026(-) (degQ) [Bacillus velezensis strain SMT-24]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1074780 ACCO34_RS15935 WP_003152043.1 3146886..3147026(-) (degQ) [Bacillus velezensis strain SMT-24]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment