Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACCO34_RS12045 Genome accession   NZ_CP174160
Coordinates   2467956..2468333 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain SMT-24     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2462956..2473333
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO34_RS12005 - 2463454..2464248 (+) 795 WP_139890050.1 YqhG family protein -
  ACCO34_RS12010 sinI 2464425..2464598 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACCO34_RS12015 sinR 2464632..2464967 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACCO34_RS12020 tasA 2465015..2465800 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  ACCO34_RS12025 sipW 2465864..2466448 (-) 585 WP_109567595.1 signal peptidase I SipW -
  ACCO34_RS12030 tapA 2466420..2467091 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  ACCO34_RS12035 - 2467351..2467680 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACCO34_RS12040 - 2467720..2467899 (-) 180 WP_003153093.1 YqzE family protein -
  ACCO34_RS12045 comGG 2467956..2468333 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCO34_RS12050 comGF 2468334..2468834 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  ACCO34_RS12055 comGE 2468743..2469057 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACCO34_RS12060 comGD 2469041..2469478 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACCO34_RS12065 comGC 2469468..2469776 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACCO34_RS12070 comGB 2469781..2470818 (-) 1038 WP_139890049.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACCO34_RS12075 comGA 2470805..2471875 (-) 1071 WP_139890048.1 competence type IV pilus ATPase ComGA Machinery gene
  ACCO34_RS12080 - 2472067..2473017 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=1074759 ACCO34_RS12045 WP_014305410.1 2467956..2468333(-) (comGG) [Bacillus velezensis strain SMT-24]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1074759 ACCO34_RS12045 WP_014305410.1 2467956..2468333(-) (comGG) [Bacillus velezensis strain SMT-24]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment