Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACCO34_RS12010 Genome accession   NZ_CP174160
Coordinates   2464425..2464598 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SMT-24     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2459425..2469598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO34_RS11995 gcvT 2460243..2461343 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  ACCO34_RS12000 - 2461766..2463436 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACCO34_RS12005 - 2463454..2464248 (+) 795 WP_139890050.1 YqhG family protein -
  ACCO34_RS12010 sinI 2464425..2464598 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACCO34_RS12015 sinR 2464632..2464967 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACCO34_RS12020 tasA 2465015..2465800 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  ACCO34_RS12025 sipW 2465864..2466448 (-) 585 WP_109567595.1 signal peptidase I SipW -
  ACCO34_RS12030 tapA 2466420..2467091 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  ACCO34_RS12035 - 2467351..2467680 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACCO34_RS12040 - 2467720..2467899 (-) 180 WP_003153093.1 YqzE family protein -
  ACCO34_RS12045 comGG 2467956..2468333 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCO34_RS12050 comGF 2468334..2468834 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  ACCO34_RS12055 comGE 2468743..2469057 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACCO34_RS12060 comGD 2469041..2469478 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1074757 ACCO34_RS12010 WP_003153105.1 2464425..2464598(+) (sinI) [Bacillus velezensis strain SMT-24]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1074757 ACCO34_RS12010 WP_003153105.1 2464425..2464598(+) (sinI) [Bacillus velezensis strain SMT-24]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment