Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACCH06_RS12750 Genome accession   NZ_CP174157
Coordinates   2586381..2586776 (-) Length   131 a.a.
NCBI ID   WP_309484978.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SHZ-24     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2581381..2591776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCH06_RS12710 sinI 2582289..2582462 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  ACCH06_RS12715 sinR 2582496..2582831 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACCH06_RS12720 tasA 2583022..2583804 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  ACCH06_RS12725 sipW 2583869..2584441 (-) 573 WP_010789195.1 signal peptidase I SipW -
  ACCH06_RS12730 tapA 2584425..2585126 (-) 702 WP_406589046.1 amyloid fiber anchoring/assembly protein TapA -
  ACCH06_RS12735 - 2585387..2585710 (+) 324 WP_406589047.1 YqzG/YhdC family protein -
  ACCH06_RS12740 - 2585757..2585936 (-) 180 WP_003325435.1 YqzE family protein -
  ACCH06_RS12745 comGG 2586006..2586380 (-) 375 WP_258729498.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCH06_RS12750 comGF 2586381..2586776 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACCH06_RS12755 comGE 2586790..2587137 (-) 348 WP_258729499.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACCH06_RS12760 comGD 2587121..2587561 (-) 441 WP_106046743.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACCH06_RS12765 comGC 2587551..2587850 (-) 300 WP_003325429.1 competence type IV pilus major pilin ComGC Machinery gene
  ACCH06_RS12770 comGB 2587865..2588902 (-) 1038 WP_258729500.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACCH06_RS12775 comGA 2588889..2589959 (-) 1071 WP_406589048.1 competence type IV pilus ATPase ComGA Machinery gene
  ACCH06_RS12780 - 2590342..2591295 (-) 954 WP_258729502.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14825.21 Da        Isoelectric Point: 8.4718

>NTDB_id=1074680 ACCH06_RS12750 WP_309484978.1 2586381..2586776(-) (comGF) [Bacillus atrophaeus strain SHZ-24]
MSVYLLISGSLAMIFYQFLSRQLEGEGVKQEEWIISVEQMMNECKQAESVQLTDKGGGVLCRNGSGREILFEKYHKMIRK
RVDGKGHVPILQHINTLKADIKNGMLILSVTSEDHKEYKTSFPIYTSLKGG

Nucleotide


Download         Length: 396 bp        

>NTDB_id=1074680 ACCH06_RS12750 WP_309484978.1 2586381..2586776(-) (comGF) [Bacillus atrophaeus strain SHZ-24]
CTGTCAGTTTATCTGCTCATATCAGGCTCTTTAGCCATGATCTTTTATCAGTTTTTATCCCGTCAACTGGAGGGGGAGGG
AGTCAAGCAGGAGGAATGGATCATTTCCGTTGAGCAAATGATGAATGAATGTAAGCAGGCTGAGAGTGTGCAGCTGACTG
ATAAGGGCGGCGGTGTGCTGTGCAGGAATGGTTCAGGCCGAGAGATTCTTTTTGAAAAATATCATAAAATGATCAGGAAA
AGAGTGGACGGTAAAGGGCATGTCCCGATTCTTCAGCATATTAACACATTGAAAGCTGATATAAAAAACGGCATGCTGAT
CTTGAGCGTAACAAGCGAAGACCATAAAGAGTACAAAACCTCTTTTCCTATTTATACATCATTGAAAGGAGGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

58.268

96.947

0.565


Multiple sequence alignment