Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACCH06_RS12710 Genome accession   NZ_CP174157
Coordinates   2582289..2582462 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SHZ-24     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2577289..2587462
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCH06_RS12695 gcvT 2578060..2579154 (-) 1095 WP_406589044.1 glycine cleavage system aminomethyltransferase GcvT -
  ACCH06_RS12700 - 2579614..2581284 (+) 1671 WP_406589045.1 DEAD/DEAH box helicase -
  ACCH06_RS12705 - 2581305..2582099 (+) 795 WP_003325443.1 YqhG family protein -
  ACCH06_RS12710 sinI 2582289..2582462 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  ACCH06_RS12715 sinR 2582496..2582831 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACCH06_RS12720 tasA 2583022..2583804 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  ACCH06_RS12725 sipW 2583869..2584441 (-) 573 WP_010789195.1 signal peptidase I SipW -
  ACCH06_RS12730 tapA 2584425..2585126 (-) 702 WP_406589046.1 amyloid fiber anchoring/assembly protein TapA -
  ACCH06_RS12735 - 2585387..2585710 (+) 324 WP_406589047.1 YqzG/YhdC family protein -
  ACCH06_RS12740 - 2585757..2585936 (-) 180 WP_003325435.1 YqzE family protein -
  ACCH06_RS12745 comGG 2586006..2586380 (-) 375 WP_258729498.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCH06_RS12750 comGF 2586381..2586776 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACCH06_RS12755 comGE 2586790..2587137 (-) 348 WP_258729499.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=1074677 ACCH06_RS12710 WP_003325442.1 2582289..2582462(+) (sinI) [Bacillus atrophaeus strain SHZ-24]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1074677 ACCH06_RS12710 WP_003325442.1 2582289..2582462(+) (sinI) [Bacillus atrophaeus strain SHZ-24]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789

Multiple sequence alignment