Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJED3_RS17580 Genome accession   NZ_CP174155
Coordinates   3303997..3304137 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain G01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3298997..3309137
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJED3_RS17550 yueI 3299293..3299691 (+) 399 WP_014480710.1 YueI family protein -
  ACJED3_RS17555 pncA 3299788..3300339 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  ACJED3_RS17560 pncB 3300355..3301827 (+) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  ACJED3_RS17565 pdeH 3301963..3303192 (+) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  ACJED3_RS17570 - 3303168..3303536 (-) 369 WP_014477834.1 hypothetical protein -
  ACJED3_RS17575 - 3303650..3303775 (-) 126 WP_003228793.1 hypothetical protein -
  ACJED3_RS17580 degQ 3303997..3304137 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACJED3_RS17585 - 3304322..3305185 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  ACJED3_RS17590 comX 3305187..3305408 (+) 222 WP_014480704.1 competence pheromone ComX -
  ACJED3_RS17595 comP 3305424..3307736 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  ACJED3_RS17600 comA 3307817..3308461 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACJED3_RS17605 yuxO 3308480..3308860 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1074610 ACJED3_RS17580 WP_003220708.1 3303997..3304137(+) (degQ) [Bacillus subtilis strain G01]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1074610 ACJED3_RS17580 WP_003220708.1 3303997..3304137(+) (degQ) [Bacillus subtilis strain G01]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment