Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AABA74_RS15080 Genome accession   NZ_AP028932
Coordinates   3049417..3049557 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain RB.IBE29     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3044417..3054557
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA74_RS15055 (RBIBE_28950) - 3044776..3045159 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  AABA74_RS15060 (RBIBE_28960) comA 3045181..3045825 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AABA74_RS15065 - 3045906..3048193 (-) 2288 Protein_2900 histidine kinase -
  AABA74_RS15070 (RBIBE_28990) comX 3048207..3048380 (-) 174 WP_012118314.1 competence pheromone ComX -
  AABA74_RS15075 (RBIBE_29000) - 3048349..3049209 (-) 861 WP_159073777.1 polyprenyl synthetase family protein -
  AABA74_RS15080 (RBIBE_29010) degQ 3049417..3049557 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AABA74_RS15085 (RBIBE_29020) - 3050023..3050364 (+) 342 WP_014305721.1 hypothetical protein -
  AABA74_RS15090 (RBIBE_29030) - 3050371..3051591 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  AABA74_RS15095 (RBIBE_29040) - 3051721..3053187 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AABA74_RS15100 (RBIBE_29050) - 3053205..3053756 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AABA74_RS15105 (RBIBE_29060) - 3053853..3054251 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=107445 AABA74_RS15080 WP_003152043.1 3049417..3049557(-) (degQ) [Bacillus velezensis strain RB.IBE29]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=107445 AABA74_RS15080 WP_003152043.1 3049417..3049557(-) (degQ) [Bacillus velezensis strain RB.IBE29]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment